Clone RE19416 Report

Search the DGRC for RE19416

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:194
Well:16
Vector:pFlc-1
Associated Gene/TranscriptmRpL41-RA
Protein status:RE19416.pep: gold
Preliminary Size:448
Sequenced Size:606

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12954 2001-12-14 Blastp of sequenced clone
CG12954 2002-01-01 Sim4 clustering to Release 2
CG12954 2003-01-01 Sim4 clustering to Release 3
mRpL41 2008-04-29 Release 5.5 accounting
mRpL41 2008-08-15 Release 5.9 accounting
mRpL41 2008-12-18 5.12 accounting

Clone Sequence Records

RE19416.complete Sequence

606 bp (606 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071157

> RE19416.complete
ATCTACATTTGTTATTTAACCATTTTGGTCGCCGAAAAACGAAATAAGAA
TGAATAATTGTATTAAAGTAGTGCCCATTGCCCTAAGGTGCCAGCAGAGG
ACCATCAGTACTTCATCCGTGCTGGAGGGCAAGCGGAACTTCCGTAAATT
TAACGCATACAACAAGCGCGGTACGCGCGTGGTAAAGGAAGCCCAGAAAA
CACTGGCCAATCCGCCGGTAGCCATTCACAAGCGAGGTGTACGAGACACG
GGCATACTTGTCGACGGGCAGTATGTGGAGATTCCCGAGAAAATTCCGGA
CATCATAGTTCCCGATTTGACCGGTTGTAAGCTAAAGCCATACGTGTCCT
ATAAGGCGCCGGACGTCGTCCAGTCGGAGTTCACCAGCTTGGATCTCTTC
AACGCCGTCTACTCGCAGAAGATTATCGAAGATTTCAAGGCGGGAAAACT
GCAGAAGGACGGCAGCGCCAAGGAGCCCTCGGTCAATGAGCAACTGACTC
CGGAGGAGGCCTTGCAACGCGCTCGAAAGACGGGCAGCGATATATTCTAG
ACATAGGTTTATTGTTTCTTAAATACAGAGTCTAAACTCGAAAAAAAAAA
AAAAAA

RE19416.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:20
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL41-RA 591 mRpL41-RA 1..591 1..591 2955 100 Plus
CG11808-RA 842 CG11808-RA 767..842 591..516 380 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 04:47:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 11104234..11104823 590..1 2950 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 04:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 15217023..15217613 591..1 2955 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 15218222..15218812 591..1 2955 100 Minus
Blast to na_te.dros performed 2019-03-16 04:47:39
Subject Length Description Subject Range Query Range Score Percent Strand
Rt1c 5443 Rt1c RT1C 5443bp 3431..3568 339..478 118 55.7 Plus

RE19416.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 04:48:27 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 11104234..11104823 1..590 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:14 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..501 50..550 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:56 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..501 50..550 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:42:05 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..501 50..550 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:32 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..501 50..550 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:50:57 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..501 50..550 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:31 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:56 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:42:05 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 5..594 1..590 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:32 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 1..590 1..590 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:50:57 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL41-RA 5..594 1..590 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:27 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15217024..15217613 1..590 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:27 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15217024..15217613 1..590 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 04:48:27 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15217024..15217613 1..590 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:42:05 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11104529..11105118 1..590 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:33 Download gff for RE19416.complete
Subject Subject Range Query Range Percent Splice Strand
2R 15218223..15218812 1..590 100   Minus

RE19416.pep Sequence

Translation from 49 to 549

> RE19416.pep
MNNCIKVVPIALRCQQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQK
TLANPPVAIHKRGVRDTGILVDGQYVEIPEKIPDIIVPDLTGCKLKPYVS
YKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAKEPSVNEQLT
PEEALQRARKTGSDIF*

RE19416.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12623-PA 166 GF12623-PA 1..166 1..166 765 83.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:30:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22368-PA 166 GG22368-PA 1..166 1..166 846 96.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20793-PA 166 GH20793-PA 1..166 1..166 748 81.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:07:33
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL41-PA 166 CG12954-PA 1..166 1..166 848 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:30:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20877-PA 166 GI20877-PA 1..166 1..166 704 77.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11472-PA 166 GL11472-PA 1..166 1..166 730 81.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11937-PA 166 GA11937-PA 1..166 1..166 725 81.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:30:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20152-PA 166 GM20152-PA 1..166 1..166 862 98.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25631-PA 166 GD25631-PA 1..166 1..166 861 98.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20612-PA 166 GJ20612-PA 1..166 1..166 763 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19706-PA 166 GK19706-PA 1..166 1..166 705 80.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:30:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12256-PA 166 GE12256-PA 1..166 1..166 850 97 Plus

RE19416.hyp Sequence

Translation from 49 to 549

> RE19416.hyp
MNNCIKVVPIALRCQQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQK
TLANPPVAIHKRGVRDTGILVDGQYVEIPEKIPDIIVPDLTGCKLKPYVS
YKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAKEPSVNEQLT
PEEALQRARKTGSDIF*

RE19416.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:14:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL41-PA 166 CG12954-PA 1..166 1..166 848 100 Plus