BDGP Sequence Production Resources |
Search the DGRC for RE19416
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 194 |
Well: | 16 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpL41-RA |
Protein status: | RE19416.pep: gold |
Preliminary Size: | 448 |
Sequenced Size: | 606 |
Gene | Date | Evidence |
---|---|---|
CG12954 | 2001-12-14 | Blastp of sequenced clone |
CG12954 | 2002-01-01 | Sim4 clustering to Release 2 |
CG12954 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpL41 | 2008-04-29 | Release 5.5 accounting |
mRpL41 | 2008-08-15 | Release 5.9 accounting |
mRpL41 | 2008-12-18 | 5.12 accounting |
606 bp (606 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071157
> RE19416.complete ATCTACATTTGTTATTTAACCATTTTGGTCGCCGAAAAACGAAATAAGAA TGAATAATTGTATTAAAGTAGTGCCCATTGCCCTAAGGTGCCAGCAGAGG ACCATCAGTACTTCATCCGTGCTGGAGGGCAAGCGGAACTTCCGTAAATT TAACGCATACAACAAGCGCGGTACGCGCGTGGTAAAGGAAGCCCAGAAAA CACTGGCCAATCCGCCGGTAGCCATTCACAAGCGAGGTGTACGAGACACG GGCATACTTGTCGACGGGCAGTATGTGGAGATTCCCGAGAAAATTCCGGA CATCATAGTTCCCGATTTGACCGGTTGTAAGCTAAAGCCATACGTGTCCT ATAAGGCGCCGGACGTCGTCCAGTCGGAGTTCACCAGCTTGGATCTCTTC AACGCCGTCTACTCGCAGAAGATTATCGAAGATTTCAAGGCGGGAAAACT GCAGAAGGACGGCAGCGCCAAGGAGCCCTCGGTCAATGAGCAACTGACTC CGGAGGAGGCCTTGCAACGCGCTCGAAAGACGGGCAGCGATATATTCTAG ACATAGGTTTATTGTTTCTTAAATACAGAGTCTAAACTCGAAAAAAAAAA AAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 11104234..11104823 | 590..1 | 2950 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 15217023..15217613 | 591..1 | 2955 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 15218222..15218812 | 591..1 | 2955 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Rt1c | 5443 | Rt1c RT1C 5443bp | 3431..3568 | 339..478 | 118 | 55.7 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 11104234..11104823 | 1..590 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..501 | 50..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..501 | 50..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..501 | 50..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..501 | 50..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..501 | 50..550 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..590 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..590 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 5..594 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 1..590 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpL41-RA | 5..594 | 1..590 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15217024..15217613 | 1..590 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15217024..15217613 | 1..590 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15217024..15217613 | 1..590 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 11104529..11105118 | 1..590 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 15218223..15218812 | 1..590 | 100 | Minus |
Translation from 49 to 549
> RE19416.pep MNNCIKVVPIALRCQQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQK TLANPPVAIHKRGVRDTGILVDGQYVEIPEKIPDIIVPDLTGCKLKPYVS YKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAKEPSVNEQLT PEEALQRARKTGSDIF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF12623-PA | 166 | GF12623-PA | 1..166 | 1..166 | 765 | 83.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG22368-PA | 166 | GG22368-PA | 1..166 | 1..166 | 846 | 96.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20793-PA | 166 | GH20793-PA | 1..166 | 1..166 | 748 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL41-PA | 166 | CG12954-PA | 1..166 | 1..166 | 848 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20877-PA | 166 | GI20877-PA | 1..166 | 1..166 | 704 | 77.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11472-PA | 166 | GL11472-PA | 1..166 | 1..166 | 730 | 81.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11937-PA | 166 | GA11937-PA | 1..166 | 1..166 | 725 | 81.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20152-PA | 166 | GM20152-PA | 1..166 | 1..166 | 862 | 98.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD25631-PA | 166 | GD25631-PA | 1..166 | 1..166 | 861 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20612-PA | 166 | GJ20612-PA | 1..166 | 1..166 | 763 | 84.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19706-PA | 166 | GK19706-PA | 1..166 | 1..166 | 705 | 80.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE12256-PA | 166 | GE12256-PA | 1..166 | 1..166 | 850 | 97 | Plus |
Translation from 49 to 549
> RE19416.hyp MNNCIKVVPIALRCQQRTISTSSVLEGKRNFRKFNAYNKRGTRVVKEAQK TLANPPVAIHKRGVRDTGILVDGQYVEIPEKIPDIIVPDLTGCKLKPYVS YKAPDVVQSEFTSLDLFNAVYSQKIIEDFKAGKLQKDGSAKEPSVNEQLT PEEALQRARKTGSDIF*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpL41-PA | 166 | CG12954-PA | 1..166 | 1..166 | 848 | 100 | Plus |