Clone RE19513 Report

Search the DGRC for RE19513

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:195
Well:13
Vector:pFlc-1
Associated Gene/Transcriptsun-RA
Protein status:RE19513.pep: gold
Sequenced Size:836

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9032 2001-12-14 Blastp of sequenced clone
CG9032 2002-01-01 Sim4 clustering to Release 2
sun 2008-04-29 Release 5.5 accounting
sun 2008-04-29 Stopped prior to 5.5
sun 2008-08-15 Release 5.9 accounting
sun 2008-12-18 5.12 accounting

Clone Sequence Records

RE19513.complete Sequence

836 bp (836 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071158

> RE19513.complete
ACTGACCGGATTCAGAAAGGGAATATCTTATATATTTTTTGTGTAGCGTG
AATATATTTCGAATAAACCGATCACAATGACTGCCTGGAGAGCTGCCGGA
ATTACCTACATCCAATACTCCAACATCGCCGCTCGCATTTTGCGCGAGTC
CTTGAAGACGGGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATG
TGAAGTTCACTCCCTGGGCAAATGGCAAGCCAGCTCAGCGTCAAACCCAA
TCGGAATCCTAGATGCTTTTCAGTGGCCACTCGAGAATGATTCGCAACAA
CTAAGATCCGCCGAAGCTGCAATGTTGTAAAATCATGAAAAATAAATAAA
ATTAAATAAATGTAATTTATTTAAACACGATGATTTTAATTGTTCTTAAA
TGTGGCATTTATTTGGGCGTTCCGTTTAGAGATCGCGACCGATGAAACGG
ACTTCTAGCAAAGATTTAAATATAGACTCAATAGAATATTGTAATTTTGA
AAAGAACTATTGGTCAGGTTCACCAGAAGCCTTTTAATTGGGATCAGTGA
TAGGTTTCTTGCTATAATTTTGTCAACGCATATTTGTATAGAATGATTTT
ATACACATAATGCTGAACCAATTGAATTGTTACTTATATTTTGCGCTTTA
AATATACACATATAGACATTATTTATGTTAATTATTATCCAGTTAGTTTA
TATTTTAATTTAAATATATATATATATATATTTTTAAGGTAGAGTATTTT
GGATTATCCTTCAAAAATTATCGATTTGCTACCACTAAGACCGATTAAAT
TGCTACCGAAGTGCTATTTCAAAAAAAAAAAAAAAA

RE19513.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:40
Subject Length Description Subject Range Query Range Score Percent Strand
sun-RA 948 sun-RA 129..948 1..820 4100 100 Plus
sun-RB 998 sun-RB 414..998 236..820 2925 100 Plus
CG8578-RA 1683 CG8578-RA 1438..1683 822..577 1230 100 Minus
sun-RB 998 sun-RB 129..365 1..237 1185 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:55:00
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 15737262..15737845 820..237 2920 100 Minus
chrX 22417052 chrX 15738727..15738857 236..106 655 100 Minus
chrX 22417052 chrX 15738977..15739081 105..1 525 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:11 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:54:58
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 15847419..15848004 822..237 2930 100 Minus
X 23542271 X 15848886..15849016 236..106 655 100 Minus
X 23542271 X 15849136..15849240 105..1 525 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:36
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 15855517..15856102 822..237 2930 100 Minus
X 23527363 X 15856984..15857114 236..106 655 100 Minus
X 23527363 X 15857234..15857338 105..1 525 100 Minus
Blast to na_te.dros performed on 2019-03-16 18:54:58 has no hits.

RE19513.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:55:41 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 15738727..15738857 106..236 100 <- Minus
chrX 15738977..15739081 1..105 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:20 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 77..262 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:29 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 77..262 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:16 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 77..262 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:45 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 77..262 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:54:51 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..186 77..262 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:29 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:29 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:16 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 19..400 1..382 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:45 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
sun-RA 1..820 1..820 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:54:51 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
CG8578-RC 1410..1847 383..820 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:41 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
X 15847421..15848004 237..820 100 <- Minus
X 15848886..15849016 106..236 100 <- Minus
X 15849136..15849240 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:41 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
X 15847421..15848004 237..820 100 <- Minus
X 15848886..15849016 106..236 100 <- Minus
X 15849136..15849240 1..105 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:41 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
X 15847421..15848004 237..820 100 <- Minus
X 15848886..15849016 106..236 100 <- Minus
X 15849136..15849240 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:16 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 15741454..15742037 237..820 100 <- Minus
arm_X 15742919..15743049 106..236 100 <- Minus
arm_X 15743169..15743273 1..105 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:42 Download gff for RE19513.complete
Subject Subject Range Query Range Percent Splice Strand
X 15855519..15856102 237..820 100 <- Minus
X 15856984..15857114 106..236 100 <- Minus
X 15857234..15857338 1..105 100   Minus

RE19513.pep Sequence

Translation from 76 to 261

> RE19513.pep
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAQRQTQSES*

RE19513.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:02:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17416-PA 82 GF17416-PA 1..54 1..54 251 85.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19366-PA 61 GG19366-PA 1..61 1..61 316 100 Plus
Dere\GG17423-PA 64 GG17423-PA 1..61 1..61 218 60.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12534-PA 56 GH12534-PA 4..56 3..55 234 81.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:15
Subject Length Description Subject Range Query Range Score Percent Strand
sun-PA 61 CG9032-PA 1..61 1..61 312 100 Plus
sun-PB 57 CG9032-PB 1..56 1..56 275 94.6 Plus
ATPsynepsilonL-PC 64 CG31477-PC 1..64 1..61 221 68.8 Plus
ATPsynepsilonL-PB 64 CG31477-PB 1..64 1..61 221 68.8 Plus
ATPsynepsilonL-PA 64 CG31477-PA 1..64 1..61 221 68.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:02:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11196-PA 56 GI11196-PA 3..56 2..55 224 74.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18058-PA 62 GL18058-PA 4..62 3..61 266 84.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:02:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21492-PA 62 GA21492-PA 4..62 3..61 266 84.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22520-PA 61 GM22520-PA 1..61 1..61 316 100 Plus
Dsec\GM23863-PA 64 GM23863-PA 1..56 1..56 219 71.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24676-PA 61 GD24676-PA 1..61 1..61 316 100 Plus
Dsim\GD18671-PA 64 GD18671-PA 1..56 1..56 219 71.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:02:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18479-PA 56 GJ18479-PA 4..56 3..55 240 84.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19782-PA 62 GK19782-PA 3..62 2..61 266 83.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:02:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16014-PA 61 GE16014-PA 1..61 1..61 316 100 Plus
Dyak\GE26014-PA 64 GE26014-PA 1..59 1..59 220 62.7 Plus

RE19513.hyp Sequence

Translation from 76 to 261

> RE19513.hyp
MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANG
KPAQRQTQSES*

RE19513.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:52:14
Subject Length Description Subject Range Query Range Score Percent Strand
sun-PA 61 CG9032-PA 1..61 1..61 312 100 Plus
sun-PB 57 CG9032-PB 1..56 1..56 275 94.6 Plus
CG31477-PC 64 CG31477-PC 1..64 1..61 221 68.8 Plus
CG31477-PB 64 CG31477-PB 1..64 1..61 221 68.8 Plus
CG31477-PA 64 CG31477-PA 1..64 1..61 221 68.8 Plus