Clone RE19570 Report

Search the DGRC for RE19570

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:195
Well:70
Vector:pFlc-1
Associated Gene/TranscriptVps20-RA
Protein status:RE19570.pep: gold
Sequenced Size:742

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG4071 2002-01-01 Sim4 clustering to Release 2
Vps20-RA 2010-11-11 Gleaning Pick By Joe Carlson

Clone Sequence Records

RE19570.complete Sequence

742 bp assembled on 2010-12-02

GenBank Submission: BT125800.1

> RE19570.complete
GCTGGTCATGGGAGCTTTGTTTGGAAAAACCAGCAAAAAGACGGCTCCTA
GTCGGATCACCGACCAGGACAAGGCGGTTCTGCAATTGAAGCAACAGAGG
GATCGTCTGAAGCAGTACCAAAAACGCATCGAGACGCAGTTGGAGAATGA
TCGCCTCCTGGCAAGGAAGTGCCTACAGCAAGGTCGCAAGGACCGGGCCA
AGCTGCTGCTGCGCAAGAAGAAGTACCAGGAGAGTCTGCTGACCAATGCC
GACAAACAGCTGGAAAACCTGGAGAAGCTGGCTGCGGACATTGAGTTCGC
CCAGGTGGAGATGAAGGTGCTGGACGGCCTCAAAGCGGGCAATGCTGCTC
TGAAGAAGGTGCACGAAATGCTTGACATCGACGAAGTTGAGCGAATCATG
GACGAGACACGCGAGGGCATCGAAAAGCAGCAGGAAATAGACGCCATACT
GACGGATGTGCTGACCACGCAGGACGAGGAGGACGTTTTGGCCGAGCTGG
ATGCCCTGGAGGCGGAGGAAGAGCAGCAGAAGGGTGCACAGCTGCCGGAT
GTGCCCACCGAAGATCTGCCCATTCCCGCTGAGATCGAGTCCGTCGAGGA
GCCGGCAAAGACCAAAGCAACCAAGAAAGTCCTGGTGGAGGCATAGAACC
TATAGTAAAACGAAACCAATGCCATTTTGTATGTATATATGTCGTTCAAC
TAAATTTCTCGATAAGTCCAATGTGAAAAAAAAAAAAAAAAA

RE19570.complete Blast Records

Blast to d_melanogaster_OreR.fa performed 2019-03-17 01:13:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18495347..18495891 193..725 2510 97.8 Plus
chr2R 21145070 chr2R 18495174..18495284 82..192 555 100 Plus
chr2R 21145070 chr2R 18495032..18495109 5..82 390 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2019-03-17 01:13:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 22608856..22609391 193..728 2680 100 Plus
2R 25286936 2R 22608683..22608793 82..192 555 100 Plus
2R 25286936 2R 22608541..22608618 5..82 390 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 23:00:22
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 22610055..22610590 193..728 2680 100 Plus
2R 25260384 2R 22609882..22609992 82..192 555 100 Plus
2R 25260384 2R 22609740..22609817 5..82 390 100 Plus
Blast to na_te.dros performed on 2019-03-17 01:13:35 has no hits.

RE19570.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-17 01:14:36 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18495028..18495109 1..82 97 -> Plus
chr2R 18495175..18495284 83..192 100 -> Plus
chr2R 18495347..18495891 193..725 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-12-03 14:28:58 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 13:42:26 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-03 20:32:48 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 17:52:20 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 1..639 8..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-12-03 14:28:58 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 5..729 1..725 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 13:42:25 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 5..729 1..725 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-03 20:32:48 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 17..741 1..725 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 17:52:20 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
Vps20-RA 17..741 1..725 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:36 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22608537..22608618 1..82 97 -> Plus
2R 22608684..22608793 83..192 100 -> Plus
2R 22608856..22609388 193..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:36 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22608537..22608618 1..82 97 -> Plus
2R 22608684..22608793 83..192 100 -> Plus
2R 22608856..22609388 193..725 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-17 01:14:36 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22608537..22608618 1..82 97 -> Plus
2R 22608684..22608793 83..192 100 -> Plus
2R 22608856..22609388 193..725 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-03 20:32:48 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18496042..18496123 1..82 97 -> Plus
arm_2R 18496189..18496298 83..192 100 -> Plus
arm_2R 18496361..18496893 193..725 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 19:45:59 Download gff for RE19570.complete
Subject Subject Range Query Range Percent Splice Strand
2R 22610055..22610587 193..725 100   Plus
2R 22609736..22609817 1..82 97 -> Plus
2R 22609883..22609992 83..192 100 -> Plus

RE19570.hyp Sequence

Translation from 0 to 645

> RE19570.hyp
LVMGALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLEND
RLLARKCLQQGRKDRAKLLLRKKKYQESLLTNADKQLENLEKLAADIEFA
QVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDETREGIEKQQEIDAIL
TDVLTTQDEEDVLAELDALEAEEEQQKGAQLPDVPTEDLPIPAEIESVEE
PAKTKATKKVLVEA*

RE19570.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:01:38
Subject Length Description Subject Range Query Range Score Percent Strand
Vps20-PC 212 CG4071-PC 1..212 3..214 1040 100 Plus
Vps20-PA 212 CG4071-PA 1..212 3..214 1040 100 Plus
shrb-PA 226 CG8055-PA 5..211 4..213 202 31.8 Plus
CG5498-PB 448 CG5498-PB 239..400 19..182 156 25.9 Plus

RE19570.pep Sequence

Translation from 1 to 645

> RE19570.pep
LVMGALFGKTSKKTAPSRITDQDKAVLQLKQQRDRLKQYQKRIETQLEND
RLLARKCLQQGRKDRAKLLLRKKKYQESLLTNADKQLENLEKLAADIEFA
QVEMKVLDGLKAGNAALKKVHEMLDIDEVERIMDETREGIEKQQEIDAIL
TDVLTTQDEEDVLAELDALEAEEEQQKGAQLPDVPTEDLPIPAEIESVEE
PAKTKATKKVLVEA*

RE19570.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 10:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11904-PA 219 GF11904-PA 1..219 3..214 924 87.7 Plus
Dana\GF12950-PA 226 GF12950-PA 3..195 2..190 157 29.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 10:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21058-PA 216 GG21058-PA 1..216 3..214 1020 95.8 Plus
Dere\GG10579-PA 226 GG10579-PA 3..195 2..190 154 31.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 10:48:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21561-PA 221 GH21561-PA 1..221 3..214 858 79.9 Plus
Dgri\GH19872-PA 228 GH19872-PA 3..195 2..190 146 29.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:32:16
Subject Length Description Subject Range Query Range Score Percent Strand
Vps20-PC 212 CG4071-PC 1..212 3..214 1040 100 Plus
Vps20-PA 212 CG4071-PA 1..212 3..214 1040 100 Plus
shrb-PA 226 CG8055-PA 5..211 4..213 202 31.8 Plus
CG5498-PB 448 CG5498-PB 239..400 19..182 156 25.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 10:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI19533-PA 220 GI19533-PA 1..188 3..193 847 88.5 Plus
Dmoj\GI19821-PA 227 GI19821-PA 3..194 2..189 143 29.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 10:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11590-PA 212 GL11590-PA 1..212 3..214 846 82.9 Plus
Dper\GL17464-PA 231 GL17464-PA 3..195 2..190 158 31.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 10:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA17936-PA 212 GA17936-PA 1..212 3..214 846 82.9 Plus
Dpse\GA20793-PA 231 GA20793-PA 3..195 2..190 158 31.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 10:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15925-PA 216 GM15925-PA 1..216 3..214 1034 96.8 Plus
Dsec\GM20627-PA 226 GM20627-PA 3..195 2..190 153 31.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 10:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11680-PA 216 GD11680-PA 1..216 3..214 1032 96.8 Plus
Dsim\GD10100-PA 226 GD10100-PA 3..195 2..190 153 31.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 10:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21101-PA 224 GJ21101-PA 1..224 3..214 834 78 Plus
Dvir\GJ18577-PA 228 GJ18577-PA 3..195 2..190 152 29.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 10:48:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17897-PA 210 GK17897-PA 1..210 3..214 762 80.6 Plus
Dwil\GK22870-PA 227 GK22870-PA 3..195 2..190 154 30 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 10:48:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14000-PA 216 GE14000-PA 1..216 3..214 1021 95.4 Plus
Dyak\GE22521-PA 226 GE22521-PA 3..195 2..190 154 31.7 Plus