Clone RE19845 Report

Search the DGRC for RE19845

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:198
Well:45
Vector:pFlc-1
Associated Gene/Transcriptspn-D-RA
Protein status:RE19845.pep: gold
Sequenced Size:1040

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5923 2002-01-01 Sim4 clustering to Release 2
CG31069 2002-06-10 Blastp of sequenced clone
CG31069 2003-01-01 Sim4 clustering to Release 3
spn-D 2008-04-29 Release 5.5 accounting
spn-D 2008-08-15 Release 5.9 accounting
spn-D 2008-12-18 5.12 accounting

Clone Sequence Records

RE19845.complete Sequence

1040 bp (1040 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071162

> RE19845.complete
ATATGGCGCGATTGTTTTGATTATTTGCGATCCCATCTTTTGTTTTTTAA
GAGTTTTAAAAAGGATTAAGCAGTCAGGAGTTTACAATGAATCATAGATT
TGTTCGGGTTTGGGAGCCATCGCAACCAGAAGCAATTGAAAGAAGACCAT
CTGTGTCCCATGAAAACTTTCGAATATTTGATAAATCCTGCTGGGACATT
TCCCAAAGTGCCTCAAATAAGATCCTGACGGGCAAGAAAGCCCTGGACAC
TCACTTTGGAGGTGGAATATCCTTGGGTCACCTGGTTGAACTGATCGGCA
ATTCGGGCACCGGAAAGACGCAAATGTGCTTGCAACTTTGCCTAAATGTA
CAAATTCCCAAGGCAGCTGGTGGATTGGAGGGCAGTGCATTATTTATAGA
CACCAGGCAGGATTTCCATCCTGACAGATTAATGGGCCTAGCTCTGAAAC
TGGAAAGGCAGTATGCACATAGAGTTCCAGAATTTAAGGCTCACAAAATG
CTGCAGAAAATCCACTATGTGAGGTGCCCGAAACTGGATCAATTAATGGC
CACTGTGCTCAGTTGCCACAGGCATCTCGTCGATCATCCCGATATTAAGC
TGATTGTAATCGACTCCCTGGCTTTTACTCTGCGAATGCTTGAGGATGGC
GCCCATCGTTACGAGATGCTTCTGGAACTGCATGAAAGCATGCGGAGATT
GCAACGTCAACACGAATTGACCTGGGTCTTCACCAATGTGCTCACGCATC
GCTACGTCAAGCAAAAGTTCCAAGTGGAGCCCGCCTTGGGGGATCTGCAT
TCGCACTTGATCAACGAGCGCATCTGGTTTTCGGGCAGCTCTGAGCTTCA
CCTGGGCAAGTCGTGGCGAACGAGTAGATTAATTAAGGAATCCGAATGAG
GCTACATCACTTTTACTTTGTGTCGAGTTTAAGCATTAGTTAAAAATAGG
TACATGCGTATTAGGATTAAATATGCAATTATCAGATGATAATTTTTCTA
TAAAATAAAAATATGTTTAGCAAGAAAAAAAAAAAAAAAA

RE19845.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
spn-D-RA 1025 spn-D-RA 1..1025 1..1025 5125 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:06:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 22989848..22990149 723..1024 1450 98.7 Plus
chr3R 27901430 chr3R 22988906..22989128 106..328 1025 97.3 Plus
chr3R 27901430 chr3R 22989350..22989506 437..593 770 99.4 Plus
chr3R 27901430 chr3R 22989662..22989787 594..719 630 100 Plus
chr3R 27901430 chr3R 22989185..22989293 328..436 545 100 Plus
chr3R 27901430 chr3R 22988744..22988850 1..107 490 97.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27166821..27167123 723..1025 1515 100 Plus
3R 32079331 3R 27165880..27166102 106..328 1115 100 Plus
3R 32079331 3R 27166322..27166480 435..593 795 100 Plus
3R 32079331 3R 27166636..27166764 594..722 645 100 Plus
3R 32079331 3R 27166159..27166267 328..436 545 100 Plus
3R 32079331 3R 27165718..27165824 1..107 535 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 26907652..26907954 723..1025 1515 100 Plus
3R 31820162 3R 26906711..26906933 106..328 1115 100 Plus
3R 31820162 3R 26907153..26907311 435..593 795 100 Plus
3R 31820162 3R 26907467..26907595 594..722 645 100 Plus
3R 31820162 3R 26906990..26907098 328..436 545 100 Plus
3R 31820162 3R 26906549..26906655 1..107 535 100 Plus
Blast to na_te.dros performed 2019-03-15 14:06:19
Subject Length Description Subject Range Query Range Score Percent Strand
blood 7410 blood BLOOD 7410bp 1473..1505 991..1023 120 84.8 Plus

RE19845.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:07:20 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 22989848..22990149 723..1024 98   Plus
chr3R 22988744..22988849 1..106 97 -> Plus
chr3R 22988907..22989128 107..328 97 -> Plus
chr3R 22989186..22989292 329..435 100 -> Plus
chr3R 22989349..22989506 436..593 98 -> Plus
chr3R 22989662..22989790 594..722 99 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:36 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..813 87..899 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:07 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..813 87..899 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:18:38 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..813 87..899 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:40 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..813 87..899 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:50:28 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..813 87..899 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:51 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..1024 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:07 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..1024 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:18:38 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 3..1026 1..1024 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:40 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 1..1023 1..1023 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:50:28 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
spn-D-RA 3..1026 1..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:20 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27165718..27165823 1..106 100 -> Plus
3R 27165881..27166102 107..328 100 -> Plus
3R 27166160..27166266 329..435 100 -> Plus
3R 27166323..27166480 436..593 100 -> Plus
3R 27166636..27166764 594..722 100 -> Plus
3R 27166821..27167122 723..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:20 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27165718..27165823 1..106 100 -> Plus
3R 27165881..27166102 107..328 100 -> Plus
3R 27166160..27166266 329..435 100 -> Plus
3R 27166323..27166480 436..593 100 -> Plus
3R 27166636..27166764 594..722 100 -> Plus
3R 27166821..27167122 723..1024 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:20 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27165718..27165823 1..106 100 -> Plus
3R 27165881..27166102 107..328 100 -> Plus
3R 27166160..27166266 329..435 100 -> Plus
3R 27166323..27166480 436..593 100 -> Plus
3R 27166636..27166764 594..722 100 -> Plus
3R 27166821..27167122 723..1024 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:18:38 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 22991440..22991545 1..106 100 -> Plus
arm_3R 22991603..22991824 107..328 100 -> Plus
arm_3R 22991882..22991988 329..435 100 -> Plus
arm_3R 22992045..22992202 436..593 100 -> Plus
arm_3R 22992358..22992486 594..722 100 -> Plus
arm_3R 22992543..22992844 723..1024 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:48 Download gff for RE19845.complete
Subject Subject Range Query Range Percent Splice Strand
3R 26906712..26906933 107..328 100 -> Plus
3R 26906991..26907097 329..435 100 -> Plus
3R 26907154..26907311 436..593 100 -> Plus
3R 26907467..26907595 594..722 100 -> Plus
3R 26907652..26907953 723..1024 100   Plus
3R 26906549..26906654 1..106 100 -> Plus

RE19845.hyp Sequence

Translation from 86 to 898

> RE19845.hyp
MNHRFVRVWEPSQPEAIERRPSVSHENFRIFDKSCWDISQSASNKILTGK
KALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGS
ALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKL
DQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRMLEDGAHRYEMLLELHE
SMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINERIWFSG
SSELHLGKSWRTSRLIKESE*

RE19845.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:56
Subject Length Description Subject Range Query Range Score Percent Strand
spn-D-PA 270 CG31069-PA 1..270 1..270 1429 100 Plus
spn-B-PA 341 CG3325-PA 86..289 44..255 188 28.8 Plus
spn-A-PB 279 CG7948-PB 41..252 45..267 171 27.8 Plus
spn-A-PA 336 CG7948-PA 98..309 45..267 171 27.8 Plus

RE19845.pep Sequence

Translation from 86 to 898

> RE19845.pep
MNHRFVRVWEPSQPEAIERRPSVSHENFRIFDKSCWDISQSASNKILTGK
KALDTHFGGGISLGHLVELIGNSGTGKTQMCLQLCLNVQIPKAAGGLEGS
ALFIDTRQDFHPDRLMGLALKLERQYAHRVPEFKAHKMLQKIHYVRCPKL
DQLMATVLSCHRHLVDHPDIKLIVIDSLAFTLRMLEDGAHRYEMLLELHE
SMRRLQRQHELTWVFTNVLTHRYVKQKFQVEPALGDLHSHLINERIWFSG
SSELHLGKSWRTSRLIKESE*

RE19845.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23286-PA 234 GF23286-PA 2..213 40..251 812 70.8 Plus
Dana\GF16205-PA 334 GF16205-PA 94..307 45..267 166 27.6 Plus
Dana\GF17509-PA 345 GF17509-PA 55..254 6..217 164 25.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:52:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11535-PA 191 GG11535-PA 1..191 80..270 969 95.3 Plus
Dere\GG11967-PA 335 GG11967-PA 100..308 48..267 172 28.2 Plus
Dere\GG16853-PA 341 GG16853-PA 55..289 6..255 147 26.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17957-PA 246 GH17957-PA 15..241 42..266 486 43.5 Plus
Dgri\GH17480-PA 349 GH17480-PA 55..288 6..249 192 27.6 Plus
Dgri\GH18396-PA 352 GH18396-PA 112..335 46..270 181 29.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:25:14
Subject Length Description Subject Range Query Range Score Percent Strand
spn-D-PA 270 CG31069-PA 1..270 1..270 1429 100 Plus
spn-B-PA 341 CG3325-PA 86..289 44..255 188 28.8 Plus
spn-A-PB 279 CG7948-PB 41..252 45..267 171 27.8 Plus
spn-A-PA 336 CG7948-PA 98..309 45..267 171 27.8 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:52:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16495-PA 181 GI16495-PA 3..176 96..266 314 40.7 Plus
Dmoj\GI23388-PA 347 GI23388-PA 107..275 46..220 174 31.3 Plus
Dmoj\GI22807-PA 345 GI22807-PA 55..288 6..249 160 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23908-PA 191 GL23908-PA 1..190 80..269 737 71.1 Plus
Dper\GL23505-PA 348 GL23505-PA 55..295 6..268 175 25.4 Plus
Dper\GL13479-PA 335 GL13479-PA 95..318 46..270 160 28.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:52:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15983-PA 254 GA15983-PA 6..253 23..269 896 66.9 Plus
Dpse\GA17378-PA 348 GA17378-PA 55..295 6..268 177 25.8 Plus
Dpse\GA20711-PA 335 GA20711-PA 95..318 46..270 160 28.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:52:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10376-PA 270 GM10376-PA 1..270 1..270 1393 95.9 Plus
Dsec\GM12184-PA 336 GM12184-PA 101..309 48..267 173 28.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21329-PA 267 GD21329-PA 8..266 8..266 1362 97.7 Plus
Dsim\GD17366-PA 336 GD17366-PA 101..309 48..267 173 28.2 Plus
Dsim\GD18959-PA 341 GD18959-PA 55..289 6..255 146 26.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:52:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16038-PA 245 GJ16038-PA 4..237 33..266 534 45.1 Plus
Dvir\GJ10382-PA 351 GJ10382-PA 111..279 46..220 177 31.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13653-PA 269 GK13653-PA 7..269 30..267 592 44.9 Plus
Dwil\GK10943-PA 349 GK10943-PA 56..306 6..264 188 27 Plus
Dwil\GK13420-PA 355 GK13420-PA 115..212 46..152 171 36.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:52:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23723-PA 406 GE23723-PA 144..406 8..270 1278 90.5 Plus
Dyak\GE23416-PA 335 GE23416-PA 100..308 48..267 173 28.2 Plus
Dyak\GE24233-PA 341 GE24233-PA 86..289 44..255 157 29.2 Plus