Clone RE19849 Report

Search the DGRC for RE19849

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:198
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG31675-RA
Protein status:RE19849.pep: gold
Sequenced Size:1166

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14401 2002-01-01 Sim4 clustering to Release 2
CG31675 2002-02-22 Blastp of sequenced clone
CG31675 2003-01-01 Sim4 clustering to Release 3
CG31675 2008-04-29 Release 5.5 accounting
CG31675 2008-08-15 Release 5.9 accounting
CG31675 2008-12-18 5.12 accounting

Clone Sequence Records

RE19849.complete Sequence

1166 bp (1166 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084120

> RE19849.complete
AGTTCGATTTCGTGTGCGGACGTCGACTGACAGACGGCTCCAAGAATTTA
GCCGGGAAATCGGGGAAAATCAAAAAACAAAACTGAGGGAAAATTGGCAA
CGCGTGTTTACATTTTTATTTCCTACGTGCTGAGACCCAAATAAATATAA
AATAAAAGTCATTTATATAGTTGAAAACACACATTTATTTATATTCAAAA
TATATACTATATTTGCTTATACAAAACATACAGTTTTGTATGTTCAAACC
TCGTGCGGATCGTTTCAATTGCGCCGAGCAGAGCTATAAATAAGCCCGCC
ACTTGAATTATTTTCCATAAAACCATCAAATACAACAAATTCCAATCACC
AGCGAGAAAGGTGGCAAACCGATTTTCCTCCCATCAACAATGCAGCATTA
TTTACTTTTGTTTGGCGCGCTCATCTCGCTACTGGCCTCAGCTTACGCCA
TCAAGTGCTATGCCTGCGAATCCGTCTACGAGGCTAGTTGCGGCGACGAC
TTCGAAGTCGAGAACCATTTTAAATACGACTGCGCCTTCATTGCTCCTCC
GCGATTCCTGGAGAACGATCTGCTCAGCGTGAATGCCACGGCCTGTTTGA
AACGGGTATTCAAGGAAAACGGCGTGCGTAAGATCGTCAGAGGCTGCTAC
TTCGGCGAGGTAAATGCCACCGATGTGTGGTGCAAAATGGACCCCACCCT
GTCGGCGGTGCAGAACTCAAGTTGTCATGTGTGCGACAGCGAGAACTACT
GCAACGGATCGGAAAATCATCCAGTGGATAAATGGAAAATCTTCGGCAGT
CTGGTCTTGTTTCTCTTGGCAACTCAACTACTCTGAGGCGACAGGAGACG
AAGTGGAAATGTGGAAATGTGGAGCGTGAAATGAACATTAAAAGGCACAG
TAGCTTAAGTAAACCTAGTTCAATTTAGATGTATTCCCAAGGCCCAGGAC
TATCAATTAGTAAAGCCCACATTAGTAGAGCACACCATCCACAAAACCGT
TTAGCCAAATCTGCCCGGCCCACTGTATTAATGGCTAATCAACGCCGAAC
ATGGCGTATGAGCAACATCAGCACACCGAAATGAGCCGAAAAGCTGGCAA
ACAAATTTCGAACGATCCAAATACAAACTAATAAAAACTAATTTTACACG
AAAAAAAAAAAAAAAA

RE19849.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:26:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG31675.a 1525 CG31675.a 377..1525 1..1149 5745 100 Plus
CG31675-RA 1348 CG31675-RA 104..1252 1..1149 5745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:55:40
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 20867650..20868184 615..1149 2675 100 Plus
chr2L 23010047 chr2L 20866291..20866731 1..441 2190 99.8 Plus
chr2L 23010047 chr2L 20866883..20867058 440..615 880 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:55:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20869116..20869650 615..1149 2675 100 Plus
2L 23513712 2L 20867757..20868197 1..441 2205 100 Plus
2L 23513712 2L 20868349..20868524 440..615 880 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:55:01
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20869116..20869650 615..1149 2675 100 Plus
2L 23513712 2L 20867757..20868197 1..441 2205 100 Plus
2L 23513712 2L 20868349..20868524 440..615 880 100 Plus
Blast to na_te.dros performed on 2019-03-16 18:55:38 has no hits.

RE19849.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:56:45 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 20866291..20866731 1..441 99 -> Plus
chr2L 20866885..20867058 442..615 100 -> Plus
chr2L 20867651..20868184 616..1150 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:37 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..447 390..836 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:39:40 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..447 390..836 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:19:23 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..447 390..836 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:32 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..447 390..836 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:55:06 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..447 390..836 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:41 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..1149 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:39:40 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..1149 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:19:23 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 3..1151 1..1149 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:33 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 1..1149 1..1149 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:55:06 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
CG31675-RA 3..1151 1..1149 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:45 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20868351..20868524 442..615 100 -> Plus
2L 20867757..20868197 1..441 100 -> Plus
2L 20869117..20869650 616..1150 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:45 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20868351..20868524 442..615 100 -> Plus
2L 20867757..20868197 1..441 100 -> Plus
2L 20869117..20869650 616..1150 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:45 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20868351..20868524 442..615 100 -> Plus
2L 20867757..20868197 1..441 100 -> Plus
2L 20869117..20869650 616..1150 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:19:23 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20867757..20868197 1..441 100 -> Plus
arm_2L 20868351..20868524 442..615 100 -> Plus
arm_2L 20869117..20869650 616..1150 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:45 Download gff for RE19849.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20867757..20868197 1..441 100 -> Plus
2L 20868351..20868524 442..615 100 -> Plus
2L 20869117..20869650 616..1150 99   Plus

RE19849.pep Sequence

Translation from 389 to 835

> RE19849.pep
MQHYLLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAF
IAPPRFLENDLLSVNATACLKRVFKENGVRKIVRGCYFGEVNATDVWCKM
DPTLSAVQNSSCHVCDSENYCNGSENHPVDKWKIFGSLVLFLLATQLL*

RE19849.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20997-PA 152 GF20997-PA 1..151 1..147 593 80.8 Plus
Dana\GF20975-PA 148 GF20975-PA 9..147 6..148 274 40.3 Plus
Dana\GF20986-PA 148 GF20986-PA 14..127 11..124 263 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:18:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10979-PA 148 GG10979-PA 1..148 1..148 742 93.9 Plus
Dere\GG21265-PA 148 GG21265-PA 1..148 1..148 742 93.9 Plus
Dere\GG21269-PA 148 GG21269-PA 1..148 1..148 742 93.9 Plus
Dere\GG21263-PA 148 GG21263-PA 9..147 6..148 261 39.6 Plus
Dere\GG21264-PA 147 GG21264-PA 6..146 3..148 260 37.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10593-PA 153 GH10593-PA 18..132 19..133 479 73 Plus
Dgri\GH10592-PA 148 GH10592-PA 7..147 4..148 277 41.1 Plus
Dgri\GH10591-PA 148 GH10591-PA 9..147 6..148 268 41 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG31675-PA 148 CG31675-PA 1..148 1..148 801 100 Plus
CG9336-PA 148 CG9336-PA 9..147 6..148 267 40.3 Plus
CG9338-PB 147 CG9338-PB 8..146 5..148 258 38.2 Plus
CG9338-PA 147 CG9338-PA 8..146 5..148 258 38.2 Plus
CG9336-PB 115 CG9336-PB 4..114 34..148 195 37.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:18:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23220-PA 153 GI23220-PA 20..146 21..148 497 67.2 Plus
Dmoj\GI23209-PA 148 GI23209-PA 20..147 17..148 270 42.9 Plus
Dmoj\GI23198-PA 148 GI23198-PA 9..147 6..148 264 41.7 Plus
Dmoj\GI23230-PA 148 GI23230-PA 19..125 17..124 133 30.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18530-PA 150 GL18530-PA 1..149 1..147 588 80.7 Plus
Dper\GL18529-PA 148 GL18529-PA 8..147 5..148 267 39.3 Plus
Dper\GL25347-PA 148 GL25347-PA 14..147 11..148 258 41 Plus
Dper\GL18528-PA 115 GL18528-PA 4..114 34..148 195 37.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:18:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA16386-PA 150 GA16386-PA 1..149 1..147 583 79.3 Plus
Dpse\GA25674-PA 148 GA25674-PA 8..147 5..148 267 39.3 Plus
Dpse\GA21711-PA 146 GA21711-PA 16..145 15..148 246 39.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23383-PA 148 GM23383-PA 1..148 1..148 772 97.3 Plus
Dsec\GM23380-PA 148 GM23380-PA 9..147 6..148 270 40.3 Plus
Dsec\GM23382-PA 141 GM23382-PA 2..140 5..148 264 38.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:18:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24292-PA 148 GD24292-PA 1..148 1..148 774 98 Plus
Dsim\GD24291-PA 245 GD24291-PA 108..244 7..148 271 40.1 Plus
Dsim\GD24290-PA 148 GD24290-PA 9..147 6..148 269 40.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23718-PA 265 GJ23718-PA 2..141 3..143 552 71.6 Plus
Dvir\GJ23708-PA 148 GJ23708-PA 20..147 17..148 274 42.9 Plus
Dvir\GJ23697-PA 148 GJ23697-PA 9..147 6..148 266 41.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:18:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15445-PA 125 GK15445-PA 1..125 1..124 541 79.2 Plus
Dwil\GK15443-PA 148 GK15443-PA 8..129 5..126 257 43.1 Plus
Dwil\GK15441-PA 149 GK15441-PA 6..148 3..148 250 37.2 Plus
Dwil\GK15444-PA 148 GK15444-PA 8..129 5..126 242 39.8 Plus
Dwil\GK15446-PA 151 GK15446-PA 3..139 1..132 140 27.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:18:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12887-PA 148 GE12887-PA 1..148 1..148 737 92.6 Plus
Dyak\GE12885-PA 148 GE12885-PA 9..147 6..148 263 38.9 Plus
Dyak\GE12886-PA 147 GE12886-PA 6..146 3..148 261 37 Plus

RE19849.hyp Sequence

Translation from 389 to 835

> RE19849.hyp
MQHYLLLFGALISLLASAYAIKCYACESVYEASCGDDFEVENHFKYDCAF
IAPPRFLENDLLSVNATACLKRVFKENGVRKIVRGCYFGEVNATDVWCKM
DPTLSAVQNSSCHVCDSENYCNGSENHPVDKWKIFGSLVLFLLATQLL*

RE19849.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG31675-PA 148 CG31675-PA 1..148 1..148 801 100 Plus
CG9336-PA 148 CG9336-PA 9..147 6..148 267 40.3 Plus
CG9338-PB 147 CG9338-PB 8..146 5..148 258 38.2 Plus
CG9338-PA 147 CG9338-PA 8..146 5..148 258 38.2 Plus
CG9336-PB 115 CG9336-PB 4..114 34..148 195 37.1 Plus