Clone RE19904 Report

Search the DGRC for RE19904

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:199
Well:4
Vector:pFlc-1
Associated Gene/TranscriptCG9773-RA
Protein status:RE19904.pep: gold
Preliminary Size:828
Sequenced Size:1011

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9773 2002-01-01 Sim4 clustering to Release 2
CG9773 2002-04-26 Blastp of sequenced clone
CG9773 2003-01-01 Sim4 clustering to Release 3
CG9773 2008-04-29 Release 5.5 accounting
CG9773 2008-08-15 Release 5.9 accounting
CG9773 2008-12-18 5.12 accounting

Clone Sequence Records

RE19904.complete Sequence

1011 bp (1011 high quality bases) assembled on 2002-04-26

GenBank Submission: AY113422

> RE19904.complete
GGTATTTCTTGGCGCTGAGGGCGCAGCCACTCTGCTGAAAACACAAGAAA
TTTGTTTTAAACAAAACAAAATGACTCAATATAGCCACGTTAAGTATACA
CAATCGCCGACGCCGTCGGTGGTTTCCGGCTACTCGAGTGCCTCGCGTCT
CCATTCGCCATTACCGCCACCCGCCAACCACCGGAGGGACTGCCTCTCGG
CGACCACCAAGAGCTACAAATACCTGCGACGTCTGCTCAAGTTCAATCAA
ATGGACTTCGAGTTTGCCCTGTGGCAGATGCTCTACCTCTTTGTGGCGCC
CCAAAAGGTGTACCGGAACTTCAACTACCGGAAACAGACCAAGTCACAGT
TCGCCCGCGACGATCCGGCCTTTCTGGTCCTCCTGGTCGTCTGCCTATGT
GTCACCTCCCTGGGCTTTGCGTATGTGCTGGGACTGTCTTTCTGGCAGAG
CATCTCGTTCATATTCTATGTGGTATTCGTGGACTGTATTTTCGTGGGCA
TCATAATAGCCTCGTTCTTCTGGGCGGTGACGAATCGGTATCTGCGCACA
AATAGCCTGGAGCCGGATATCGAGTGGGGCTATGCCTTCGATGTCCATCT
AAATGCCTTCTTTCCGCCACTGATGCTGCTGCACTTCATCCAGCTGTTCT
TCTACAACTGGCTGATCAGCCAAACGTGGTTCATCTCGCGATTTCTGGGC
AACACCTTTTGGTTGATGGGCATGGGCTATTATGTGTACATCACATTTCT
GGGATACAATTGCATTCCCCATCTGAAAAACACCCGCATCATTCTCATCG
CCCTGCCCATCATCTTTCTACTGTTTCTGGTCGTCACAATTATTGGTTGG
AACGCAACGATATCCTTTGTCAATTTCTACAAGTATCGCGTATATTAGTA
ATGCAATGTGCGTTGTAAATTATTCTGCGTTTAGTTGCTAAGCCACTATA
CTACAATTATGACTAATAAACTAATTAATTTAGCGTTATCCAAACCAAAA
AAAAAAAAAAA

RE19904.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:11:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG9773-RA 1084 CG9773-RA 66..1062 1..997 4985 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:25:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 4502160..4502560 401..1 2005 100 Minus
chr3R 27901430 chr3R 4501544..4501905 762..401 1810 100 Minus
chr3R 27901430 chr3R 4501255..4501489 996..762 1175 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:25:31
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8676188..8676588 401..1 2005 100 Minus
3R 32079331 3R 8675572..8675933 762..401 1810 100 Minus
3R 32079331 3R 8675282..8675517 997..762 1180 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:42:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8417019..8417419 401..1 2005 100 Minus
3R 31820162 3R 8416403..8416764 762..401 1810 100 Minus
3R 31820162 3R 8416113..8416348 997..762 1180 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:25:31 has no hits.

RE19904.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:26:17 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 4501255..4501489 762..996 100 <- Minus
chr3R 4501545..4501904 402..761 100 <- Minus
chr3R 4502160..4502560 1..401 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:39 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..828 71..898 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:56:23 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..828 71..898 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:39:47 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..828 71..898 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:49:42 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..828 71..898 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:31:23 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..828 71..898 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:35:54 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:56:23 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 40..1035 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:39:47 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 26..1021 1..996 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:49:42 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 1..996 1..996 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:31:23 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
CG9773-RA 26..1021 1..996 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:17 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8675283..8675517 762..996 100 <- Minus
3R 8675573..8675932 402..761 100 <- Minus
3R 8676188..8676588 1..401 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:17 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8675283..8675517 762..996 100 <- Minus
3R 8675573..8675932 402..761 100 <- Minus
3R 8676188..8676588 1..401 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:17 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8675283..8675517 762..996 100 <- Minus
3R 8675573..8675932 402..761 100 <- Minus
3R 8676188..8676588 1..401 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:39:47 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 4501295..4501654 402..761 100 <- Minus
arm_3R 4501005..4501239 762..996 100 <- Minus
arm_3R 4501910..4502310 1..401 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:21:35 Download gff for RE19904.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8416114..8416348 762..996 100 <- Minus
3R 8416404..8416763 402..761 100 <- Minus
3R 8417019..8417419 1..401 100   Minus

RE19904.hyp Sequence

Translation from 0 to 897

> RE19904.hyp
VFLGAEGAATLLKTQEICFKQNKMTQYSHVKYTQSPTPSVVSGYSSASRL
HSPLPPPANHRRDCLSATTKSYKYLRRLLKFNQMDFEFALWQMLYLFVAP
QKVYRNFNYRKQTKSQFARDDPAFLVLLVVCLCVTSLGFAYVLGLSFWQS
ISFIFYVVFVDCIFVGIIIASFFWAVTNRYLRTNSLEPDIEWGYAFDVHL
NAFFPPLMLLHFIQLFFYNWLISQTWFISRFLGNTFWLMGMGYYVYITFL
GYNCIPHLKNTRIILIALPIIFLLFLVVTIIGWNATISFVNFYKYRVY*

RE19904.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:00:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG9773-PA 275 CG9773-PA 1..275 24..298 1478 100 Plus

RE19904.pep Sequence

Translation from 70 to 897

> RE19904.pep
MTQYSHVKYTQSPTPSVVSGYSSASRLHSPLPPPANHRRDCLSATTKSYK
YLRRLLKFNQMDFEFALWQMLYLFVAPQKVYRNFNYRKQTKSQFARDDPA
FLVLLVVCLCVTSLGFAYVLGLSFWQSISFIFYVVFVDCIFVGIIIASFF
WAVTNRYLRTNSLEPDIEWGYAFDVHLNAFFPPLMLLHFIQLFFYNWLIS
QTWFISRFLGNTFWLMGMGYYVYITFLGYNCIPHLKNTRIILIALPIIFL
LFLVVTIIGWNATISFVNFYKYRVY*

RE19904.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:26:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16844-PA 275 GF16844-PA 1..275 1..275 1421 96.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17433-PA 275 GG17433-PA 1..275 1..275 1446 99.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH19021-PA 275 GH19021-PA 1..275 1..275 1284 88.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:08:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9773-PA 275 CG9773-PA 1..275 1..275 1478 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:27:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22834-PA 275 GI22834-PA 1..275 1..275 1365 92.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12139-PA 275 GL12139-PA 1..275 1..275 1354 91.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:27:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22025-PA 275 GA22025-PA 1..275 1..275 1354 91.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26326-PA 275 GM26326-PA 1..275 1..275 1446 99.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:27:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20852-PA 275 GD20852-PA 1..275 1..275 1446 99.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24589-PA 275 GJ24589-PA 1..275 1..275 1368 92.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:27:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11280-PA 276 GK11280-PA 1..276 1..275 1303 92.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:27:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24835-PA 275 GE24835-PA 1..275 1..275 1446 99.6 Plus