Clone RE20030 Report

Search the DGRC for RE20030

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:200
Well:30
Vector:pFlc-1
Associated Gene/TranscriptCG30479-RA
Protein status:RE20030.pep: gold
Sequenced Size:605

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG30479 2003-01-01 Sim4 clustering to Release 3
CG30479 2008-04-29 Release 5.5 accounting
CG30479 2008-08-15 Release 5.9 accounting
CG30479 2008-12-18 5.12 accounting

Clone Sequence Records

RE20030.complete Sequence

605 bp (605 high quality bases) assembled on 2006-06-05

GenBank Submission: BT023829

> RE20030.complete
AGTCAGTAGTTAGCCATCGGTCGAGATGCCACCCCCAGGACGCGGATACG
GAGGACCACCTCCACGGGGTCCCGGAATCGCCTACGGACCACCGCCACCT
CGAGTGAATGTCGGCATCAATATCGGCGGACCACCGCGTCCGCCGCCCAT
AGGCGTGGGCATCGGCTTTGCTCCGCCACCCGTGGTGGTTGCACCACCGC
CACCAACTGTGATCGTCGGAGCACCACCACCACCGCCCATGGTCGTGATG
CCGCCGCCACGGCCCACCGTTGTGGTGGGTGGCCAGGCTCCGGTGGCCAG
TGTGTATGCCCAGCCGCAAGGAGAGGTTTTCTGCTGCACTATTCTCTGAC
GAAAAATAGGAAATGAAAAACTGTGCTTCTGTATAGAATTATTCACTACG
TGTACATATATGCCTTAAATAAGTAAAATAAAATAGTTAACTCATAGTAA
AGTCCACAGTCCATGTTCAATTCAAGTTCAAAATGGCTTAAAAGACATTT
TAATGCAATCAAAAATCATTGTCCAGTGTGTTGTTTTAATTTTTGAAGTG
TGAACCAATGAAAGTATTAATAAAATGAATGCAAACCATAAAAAAAAAAA
AAAAA

RE20030.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG30479-RA 589 CG30479-RA 1..589 1..589 2945 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:23:32
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10561762..10562350 589..1 2885 99.3 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:30
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14674463..14675053 591..1 2955 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14675662..14676252 591..1 2955 100 Minus
Blast to na_te.dros performed 2019-03-16 08:23:31
Subject Length Description Subject Range Query Range Score Percent Strand
G7 1192 G7 G7 1192bp 1108..1179 373..446 122 66.7 Plus
roo 9092 roo DM_ROO 9092bp 8221..8292 515..586 106 69.3 Plus

RE20030.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:24:08 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10561762..10562350 1..589 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:45 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..324 26..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:04 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..324 26..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:33 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..324 26..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:59 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..324 26..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:12 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..324 26..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:20 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..349 1..349 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:04 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..589 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:33 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 10..598 1..589 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:00 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 1..349 1..349 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:12 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
CG30479-RA 10..598 1..589 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14674465..14675053 1..589 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14674465..14675053 1..589 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14674465..14675053 1..589 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:33 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10561970..10562558 1..589 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:49 Download gff for RE20030.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14675664..14676252 1..589 100   Minus

RE20030.pep Sequence

Translation from 25 to 348

> RE20030.pep
MPPPGRGYGGPPPRGPGIAYGPPPPRVNVGINIGGPPRPPPIGVGIGFAP
PPVVVAPPPPTVIVGAPPPPPMVVMPPPRPTVVVGGQAPVASVYAQPQGE
VFCCTIL*

RE20030.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG30479-PB 107 CG30479-PB 1..107 1..107 606 100 Plus
CG30479-PA 107 CG30479-PA 1..107 1..107 606 100 Plus
dia-PE 1091 CG1768-PE 513..594 1..90 155 43.2 Plus
dia-PB 1091 CG1768-PB 513..594 1..90 155 43.2 Plus
dia-PA 1091 CG1768-PA 513..594 1..90 155 43.2 Plus
dia-PD 1098 CG1768-PD 520..601 1..90 155 43.2 Plus
capu-PG 932 CG3399-PG 364..437 2..82 152 42.9 Plus
capu-PB 1049 CG3399-PB 481..554 2..82 152 42.9 Plus
capu-PA 1059 CG3399-PA 491..564 2..82 152 42.9 Plus
capu-PJ 1089 CG3399-PJ 521..594 2..82 152 42.9 Plus
capu-PH 1107 CG3399-PH 539..612 2..82 152 42.9 Plus
capu-PD 1207 CG3399-PD 639..712 2..82 152 42.9 Plus
capu-PE 1280 CG3399-PE 712..785 2..82 152 42.9 Plus
capu-PI 1298 CG3399-PI 730..803 2..82 152 42.9 Plus
capu-PF 1361 CG3399-PF 793..866 2..82 152 42.9 Plus
CG15021-PA 420 CG15021-PA 42..171 2..98 148 35.9 Plus
WASp-PC 494 CG1520-PC 303..384 1..98 148 39.6 Plus
WASp-PD 527 CG1520-PD 336..417 1..98 148 39.6 Plus
WASp-PB 527 CG1520-PB 336..417 1..98 148 39.6 Plus
WASp-PA 527 CG1520-PA 336..417 1..98 148 39.6 Plus
Whamy-PC 514 CG12946-PC 373..445 11..89 147 41.2 Plus
Whamy-PA 514 CG12946-PA 373..445 11..89 147 41.2 Plus
Whamy-PE 596 CG12946-PE 455..527 11..89 147 41.2 Plus
Whamy-PD 596 CG12946-PD 455..527 11..89 147 41.2 Plus
Whamy-PB 630 CG12946-PB 489..561 11..89 147 41.2 Plus
CG9411-PA 993 CG9411-PA 431..501 7..89 147 42.2 Plus
Hers-PI 2529 CG32529-PI 1170..1235 2..78 144 44.3 Plus
Hers-PE 2529 CG32529-PE 1170..1235 2..78 144 44.3 Plus
Hers-PA 2529 CG32529-PA 1170..1235 2..78 144 44.3 Plus
CG32241-PB 415 CG32241-PB 286..394 2..100 141 37.2 Plus
CG32241-PB 415 CG32241-PB 186..272 2..80 140 40.7 Plus

RE20030.hyp Sequence

Translation from 25 to 348

> RE20030.hyp
MPPPGRGYGGPPPRGPGIAYGPPPPRVNVGINIGGPPRPPPIGVGIGFAP
PPVVVAPPPPTVIVGAPPPPPMVVMPPPRPTVVVGGQAPVASVYAQPQGE
VFCCTIL*

RE20030.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG30479-PB 107 CG30479-PB 1..107 1..107 606 100 Plus
CG30479-PA 107 CG30479-PA 1..107 1..107 606 100 Plus
dia-PE 1091 CG1768-PE 513..594 1..90 155 43.2 Plus
dia-PB 1091 CG1768-PB 513..594 1..90 155 43.2 Plus
dia-PA 1091 CG1768-PA 513..594 1..90 155 43.2 Plus