RE20030.complete Sequence
605 bp (605 high quality bases) assembled on 2006-06-05
GenBank Submission: BT023829
> RE20030.complete
AGTCAGTAGTTAGCCATCGGTCGAGATGCCACCCCCAGGACGCGGATACG
GAGGACCACCTCCACGGGGTCCCGGAATCGCCTACGGACCACCGCCACCT
CGAGTGAATGTCGGCATCAATATCGGCGGACCACCGCGTCCGCCGCCCAT
AGGCGTGGGCATCGGCTTTGCTCCGCCACCCGTGGTGGTTGCACCACCGC
CACCAACTGTGATCGTCGGAGCACCACCACCACCGCCCATGGTCGTGATG
CCGCCGCCACGGCCCACCGTTGTGGTGGGTGGCCAGGCTCCGGTGGCCAG
TGTGTATGCCCAGCCGCAAGGAGAGGTTTTCTGCTGCACTATTCTCTGAC
GAAAAATAGGAAATGAAAAACTGTGCTTCTGTATAGAATTATTCACTACG
TGTACATATATGCCTTAAATAAGTAAAATAAAATAGTTAACTCATAGTAA
AGTCCACAGTCCATGTTCAATTCAAGTTCAAAATGGCTTAAAAGACATTT
TAATGCAATCAAAAATCATTGTCCAGTGTGTTGTTTTAATTTTTGAAGTG
TGAACCAATGAAAGTATTAATAAAATGAATGCAAACCATAAAAAAAAAAA
AAAAA
RE20030.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 17:14:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30479-RA | 589 | CG30479-RA | 1..589 | 1..589 | 2945 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 08:23:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 10561762..10562350 | 589..1 | 2885 | 99.3 | Minus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 08:23:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 14674463..14675053 | 591..1 | 2955 | 100 | Minus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:08:08
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 14675662..14676252 | 591..1 | 2955 | 100 | Minus |
Blast to na_te.dros performed 2019-03-16 08:23:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
G7 | 1192 | G7 G7 1192bp | 1108..1179 | 373..446 | 122 | 66.7 | Plus |
roo | 9092 | roo DM_ROO 9092bp | 8221..8292 | 515..586 | 106 | 69.3 | Plus |
RE20030.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 08:24:08 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 10561762..10562350 | 1..589 | 99 | | Minus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:45 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..324 | 26..349 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:24:04 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..324 | 26..349 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:54:33 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..324 | 26..349 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:59 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..324 | 26..349 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 09:40:12 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..324 | 26..349 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:52:20 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..349 | 1..349 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:24:04 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..589 | 1..589 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:54:33 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 10..598 | 1..589 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:43:00 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 1..349 | 1..349 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 09:40:12 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG30479-RA | 10..598 | 1..589 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14674465..14675053 | 1..589 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14674465..14675053 | 1..589 | 100 | | Minus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 08:24:08 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14674465..14675053 | 1..589 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:54:33 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 10561970..10562558 | 1..589 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:49 Download gff for
RE20030.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 14675664..14676252 | 1..589 | 100 | | Minus |
RE20030.pep Sequence
Translation from 25 to 348
> RE20030.pep
MPPPGRGYGGPPPRGPGIAYGPPPPRVNVGINIGGPPRPPPIGVGIGFAP
PPVVVAPPPPTVIVGAPPPPPMVVMPPPRPTVVVGGQAPVASVYAQPQGE
VFCCTIL*
RE20030.pep Blast Records
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30479-PB | 107 | CG30479-PB | 1..107 | 1..107 | 606 | 100 | Plus |
CG30479-PA | 107 | CG30479-PA | 1..107 | 1..107 | 606 | 100 | Plus |
dia-PE | 1091 | CG1768-PE | 513..594 | 1..90 | 155 | 43.2 | Plus |
dia-PB | 1091 | CG1768-PB | 513..594 | 1..90 | 155 | 43.2 | Plus |
dia-PA | 1091 | CG1768-PA | 513..594 | 1..90 | 155 | 43.2 | Plus |
dia-PD | 1098 | CG1768-PD | 520..601 | 1..90 | 155 | 43.2 | Plus |
capu-PG | 932 | CG3399-PG | 364..437 | 2..82 | 152 | 42.9 | Plus |
capu-PB | 1049 | CG3399-PB | 481..554 | 2..82 | 152 | 42.9 | Plus |
capu-PA | 1059 | CG3399-PA | 491..564 | 2..82 | 152 | 42.9 | Plus |
capu-PJ | 1089 | CG3399-PJ | 521..594 | 2..82 | 152 | 42.9 | Plus |
capu-PH | 1107 | CG3399-PH | 539..612 | 2..82 | 152 | 42.9 | Plus |
capu-PD | 1207 | CG3399-PD | 639..712 | 2..82 | 152 | 42.9 | Plus |
capu-PE | 1280 | CG3399-PE | 712..785 | 2..82 | 152 | 42.9 | Plus |
capu-PI | 1298 | CG3399-PI | 730..803 | 2..82 | 152 | 42.9 | Plus |
capu-PF | 1361 | CG3399-PF | 793..866 | 2..82 | 152 | 42.9 | Plus |
CG15021-PA | 420 | CG15021-PA | 42..171 | 2..98 | 148 | 35.9 | Plus |
WASp-PC | 494 | CG1520-PC | 303..384 | 1..98 | 148 | 39.6 | Plus |
WASp-PD | 527 | CG1520-PD | 336..417 | 1..98 | 148 | 39.6 | Plus |
WASp-PB | 527 | CG1520-PB | 336..417 | 1..98 | 148 | 39.6 | Plus |
WASp-PA | 527 | CG1520-PA | 336..417 | 1..98 | 148 | 39.6 | Plus |
Whamy-PC | 514 | CG12946-PC | 373..445 | 11..89 | 147 | 41.2 | Plus |
Whamy-PA | 514 | CG12946-PA | 373..445 | 11..89 | 147 | 41.2 | Plus |
Whamy-PE | 596 | CG12946-PE | 455..527 | 11..89 | 147 | 41.2 | Plus |
Whamy-PD | 596 | CG12946-PD | 455..527 | 11..89 | 147 | 41.2 | Plus |
Whamy-PB | 630 | CG12946-PB | 489..561 | 11..89 | 147 | 41.2 | Plus |
CG9411-PA | 993 | CG9411-PA | 431..501 | 7..89 | 147 | 42.2 | Plus |
Hers-PI | 2529 | CG32529-PI | 1170..1235 | 2..78 | 144 | 44.3 | Plus |
Hers-PE | 2529 | CG32529-PE | 1170..1235 | 2..78 | 144 | 44.3 | Plus |
Hers-PA | 2529 | CG32529-PA | 1170..1235 | 2..78 | 144 | 44.3 | Plus |
CG32241-PB | 415 | CG32241-PB | 286..394 | 2..100 | 141 | 37.2 | Plus |
CG32241-PB | 415 | CG32241-PB | 186..272 | 2..80 | 140 | 40.7 | Plus |
RE20030.hyp Sequence
Translation from 25 to 348
> RE20030.hyp
MPPPGRGYGGPPPRGPGIAYGPPPPRVNVGINIGGPPRPPPIGVGIGFAP
PPVVVAPPPPTVIVGAPPPPPMVVMPPPRPTVVVGGQAPVASVYAQPQGE
VFCCTIL*
RE20030.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:14:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG30479-PB | 107 | CG30479-PB | 1..107 | 1..107 | 606 | 100 | Plus |
CG30479-PA | 107 | CG30479-PA | 1..107 | 1..107 | 606 | 100 | Plus |
dia-PE | 1091 | CG1768-PE | 513..594 | 1..90 | 155 | 43.2 | Plus |
dia-PB | 1091 | CG1768-PB | 513..594 | 1..90 | 155 | 43.2 | Plus |
dia-PA | 1091 | CG1768-PA | 513..594 | 1..90 | 155 | 43.2 | Plus |