Clone RE20049 Report

Search the DGRC for RE20049

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:200
Well:49
Vector:pFlc-1
Associated Gene/TranscriptCG6337-RA
Protein status:RE20049.pep: gold
Preliminary Size:1023
Sequenced Size:1131

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6337 2002-01-01 Sim4 clustering to Release 2
CG6337 2002-02-22 Blastp of sequenced clone
CG6337 2003-01-01 Sim4 clustering to Release 3
CG6337 2008-04-29 Release 5.5 accounting
CG6337 2008-08-15 Release 5.9 accounting
CG6337 2008-12-18 5.12 accounting

Clone Sequence Records

RE20049.complete Sequence

1131 bp (1131 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084123

> RE20049.complete
AGTTGGTGCGGATTTGGGTTTTCGTCATGTTCAAGTTGCTACTTTGCTGC
CTTCTACTAACCATCGACAGTGGATGGGCCTTTAATCATGGCCAGGATCT
AGTGGACTTTCAAACTTACGAGGACAATTTCAACAAGACCTATGCCTCAA
CTTCGGCTCGCAACTTCGCCAACTACTACTTCATCTACAACCGCAACCAG
GTGGCGCAGCACAATGCCCAGGCCGATAGGAATCGCACCACCTACCGCGA
GGCAGTGAATCAGTTCTCGGACATCCGGCTCATCCAGTTCGCAGCCCTGC
TGCCCAAAGCCGTGAATACGGTGACCTCGGCGGCCAGTGATCCACCGGCC
AGTCAAGCGGCATCTGCCAGCTTTGACATTATCACGGATTTCGGACTCAC
CGTGGCGGTGGAGGATCAGGGCGTGAACTGCAGCAGTAGTTGGGCCTATG
CCACCGCCAAGGCCGTGGAGATCATGAATGCCGTGCAGACAGCCAATCCT
CTGCCCTCGTCCTTGTCCGCCCAGCAGCTGCTGGACTGTGCGGGCATGGG
CACCGGATGCAGCACCCAGACGCCCCTGGCTGCCCTCAACTATCTCACCC
AGCTGACAGATGCGTATCTCTATCCGGAGGTGGACTATCCGAATAACAAT
AGCCTGAAAACGCCGGGTATGTGCCAGCCCCCATCCTCTGTGTCAGTGGG
CGTGAAGTTGGCCGGCTATTCCACGGTGGCCGACAACGATGATGCCGCCG
TAATGCGTTACGTATCGAATGGATTCCCCGTCATAGTCGAGTACAATCCG
GCTACCTTTGGATTCATGCAGTACTCCAGTGGCGTCTATGTCCAGGAGAC
GCGTGCCCTGACCAATCCAAAGAGCTCACAGTTCCTGGTGGTCGTGGGCT
ACGATCACGACGTGGACTCCAATCTGGACTACTGGCGCTGCCTGAACTCC
TTCGGCGACACGTGGGGCGAGGAGGGTTACATCAGGATCGTGCGCAGGTC
CAATCAGCCCATTGCCAAGAATGCCGTCTTTCCCAGTGCGCTTGCCTAAG
AAGGATTCCGATTTGACCTTATTTCAAGTTAATAAACTTAAGTTTTATGT
GTAAATTTTAAAAAAGAAAAAAAAAAAAAAA

RE20049.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG6337-RA 1266 CG6337-RA 51..1159 1..1109 5545 100 Plus
CG6337.a 1415 CG6337.a 31..1139 1..1109 5545 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:28:20
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 9721194..9722182 1109..121 4945 100 Minus
chr2R 21145070 chr2R 9722300..9722422 123..1 615 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:39 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:28:18
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 13833860..13834848 1109..121 4945 100 Minus
2R 25286936 2R 13834966..13835088 123..1 615 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:54
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 13835059..13836047 1109..121 4945 100 Minus
2R 25260384 2R 13836165..13836287 123..1 615 100 Minus
Blast to na_te.dros performed on 2019-03-16 07:28:19 has no hits.

RE20049.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:29:22 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 9721188..9722180 123..1116 99 <- Minus
chr2R 9722301..9722422 1..122 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:48 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1023 27..1049 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:39:21 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1023 27..1049 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:23:23 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1023 27..1049 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:21 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1023 27..1049 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:33:25 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1023 27..1049 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:23 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1115 1..1116 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:39:21 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1115 1..1116 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:23 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 9..1117 1..1109 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:21 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 1..1115 1..1116 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:33:25 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
CG6337-RA 9..1117 1..1109 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:22 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13833854..13834846 123..1116 99 <- Minus
2R 13834967..13835088 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:22 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13833854..13834846 123..1116 99 <- Minus
2R 13834967..13835088 1..122 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:29:22 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13833854..13834846 123..1116 99 <- Minus
2R 13834967..13835088 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:23 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 9721359..9722351 123..1116 99 <- Minus
arm_2R 9722472..9722593 1..122 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:33 Download gff for RE20049.complete
Subject Subject Range Query Range Percent Splice Strand
2R 13835053..13836045 123..1116 99 <- Minus
2R 13836166..13836287 1..122 100   Minus

RE20049.hyp Sequence

Translation from 2 to 1048

> RE20049.hyp
LVRIWVFVMFKLLLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYAST
SARNFANYYFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALL
PKAVNTVTSAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYA
TAKAVEIMNAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLTQ
LTDAYLYPEVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAV
MRYVSNGFPVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGY
DHDVDSNLDYWRCLNSFGDTWGEEGYIRIVRRSNQPIAKNAVFPSALA*

RE20049.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:22:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG6337-PB 340 CG6337-PB 1..340 9..348 1777 100 Plus
CG6337-PA 340 CG6337-PA 1..340 9..348 1777 100 Plus
CG11459-PB 336 CG11459-PB 29..322 35..334 238 27.8 Plus
CG11459-PA 336 CG11459-PA 29..322 35..334 238 27.8 Plus
CG6347-PA 352 CG6347-PA 32..337 33..333 230 26.4 Plus

RE20049.pep Sequence

Translation from 26 to 1048

> RE20049.pep
MFKLLLCCLLLTIDSGWAFNHGQDLVDFQTYEDNFNKTYASTSARNFANY
YFIYNRNQVAQHNAQADRNRTTYREAVNQFSDIRLIQFAALLPKAVNTVT
SAASDPPASQAASASFDIITDFGLTVAVEDQGVNCSSSWAYATAKAVEIM
NAVQTANPLPSSLSAQQLLDCAGMGTGCSTQTPLAALNYLTQLTDAYLYP
EVDYPNNNSLKTPGMCQPPSSVSVGVKLAGYSTVADNDDAAVMRYVSNGF
PVIVEYNPATFGFMQYSSGVYVQETRALTNPKSSQFLVVVGYDHDVDSNL
DYWRCLNSFGDTWGEEGYIRIVRRSNQPIAKNAVFPSALA*

RE20049.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:14:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11163-PA 342 GF11163-PA 1..342 1..340 1414 78.4 Plus
Dana\GF17600-PA 333 GF17600-PA 1..331 1..336 283 27.2 Plus
Dana\GF17358-PA 329 GF17358-PA 1..327 1..336 245 25.8 Plus
Dana\GF13722-PA 417 GF13722-PA 114..415 37..336 224 26.2 Plus
Dana\GF13714-PA 352 GF13714-PA 9..350 2..336 222 26.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:14:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22468-PA 340 GG22468-PA 1..340 1..340 1675 94.1 Plus
Dere\GG20405-PA 352 GG20405-PA 32..350 25..336 240 26.4 Plus
Dere\GG20414-PA 341 GG20414-PA 26..339 25..336 240 26.3 Plus
Dere\GG20691-PA 378 GG20691-PA 66..376 24..336 235 26.9 Plus
Dere\GG10644-PA 344 GG10644-PA 29..329 27..326 204 25.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20868-PA 336 GH20868-PA 1..335 1..339 929 52.6 Plus
Dgri\GH20767-PA 329 GH20767-PA 26..327 27..336 256 27.8 Plus
Dgri\GH21038-PA 349 GH21038-PA 34..347 24..336 239 25.6 Plus
Dgri\GH23906-PA 358 GH23906-PA 49..345 23..326 221 26.7 Plus
Dgri\GH21411-PA 391 GH21411-PA 82..378 23..326 221 26.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:22:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG6337-PB 340 CG6337-PB 1..340 1..340 1777 100 Plus
CG6337-PA 340 CG6337-PA 1..340 1..340 1777 100 Plus
CG4847-PE 390 CG4847-PE 81..388 27..336 243 28 Plus
CG4847-PC 390 CG4847-PC 81..388 27..336 243 28 Plus
CG4847-PA 390 CG4847-PA 81..388 27..336 243 28 Plus
CG4847-PD 420 CG4847-PD 111..418 27..336 243 28 Plus
CG11459-PB 336 CG11459-PB 29..322 27..326 238 27.8 Plus
CG11459-PA 336 CG11459-PA 29..322 27..326 238 27.8 Plus
CG6347-PA 352 CG6347-PA 32..337 25..325 230 26.4 Plus
Cp1-PA 341 CG6692-PA 28..339 27..336 227 26.5 Plus
Cp1-PC 371 CG6692-PC 58..369 27..336 227 26.5 Plus
Cp1-PE 338 CG6692-PE 35..336 37..336 220 27 Plus
CG5367-PA 338 CG5367-PA 35..325 27..326 196 24.8 Plus
CG12163-PB 475 CG12163-PB 159..461 20..326 178 25.1 Plus
CG12163-PA 614 CG12163-PA 298..600 20..326 178 25.1 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:14:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20975-PA 356 GI20975-PA 1..318 1..322 875 53.9 Plus
Dmoj\GI20850-PA 329 GI20850-PA 26..327 27..336 281 28.6 Plus
Dmoj\GI21205-PA 339 GI21205-PA 26..337 27..336 246 27.1 Plus
Dmoj\GI18587-PA 366 GI18587-PA 55..353 24..326 222 26.8 Plus
Dmoj\GI14103-PA 334 GI14103-PA 23..321 14..326 215 27.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16998-PA 335 GL16998-PA 1..335 1..338 1213 67.5 Plus
Dper\GL17477-PA 353 GL17477-PA 15..351 5..336 250 27.1 Plus
Dper\GL11434-PA 372 GL11434-PA 63..359 27..326 237 27 Plus
Dper\GL24978-PA 338 GL24978-PA 28..321 25..323 220 26.4 Plus
Dper\GL19003-PA 335 GL19003-PA 32..322 27..326 208 25 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:14:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19520-PA 335 GA19520-PA 1..335 1..338 1216 67.8 Plus
Dpse\GA24205-PA 353 GA24205-PA 15..351 5..336 250 27.1 Plus
Dpse\GA18475-PA 372 GA18475-PA 63..359 27..326 243 27.3 Plus
Dpse\GA23577-PA 338 GA23577-PA 28..321 25..323 212 26 Plus
Dpse\GA25021-PA 341 GA25021-PA 28..339 27..336 203 24.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:14:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20254-PA 340 GM20254-PA 1..340 1..340 1697 95.9 Plus
Dsec\GM21790-PA 382 GM21790-PA 70..369 24..326 248 29.7 Plus
Dsec\GM21500-PA 341 GM21500-PA 26..339 25..336 239 26 Plus
Dsec\GM21493-PA 352 GM21493-PA 32..350 25..336 234 27 Plus
Dsec\GM10853-PA 336 GM10853-PA 28..322 26..326 225 27.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25740-PA 340 GD25740-PA 1..340 1..340 1699 95.9 Plus
Dsim\GD11280-PA 382 GD11280-PA 70..380 24..336 242 28 Plus
Dsim\GD10995-PA 341 GD10995-PA 26..339 25..336 237 26 Plus
Dsim\GD10987-PA 352 GD10987-PA 32..350 25..336 234 27 Plus
Dsim\GD19835-PA 336 GD19835-PA 28..322 26..326 227 28.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:14:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20695-PA 342 GJ20695-PA 1..335 1..340 998 57.8 Plus
Dvir\GJ20585-PA 333 GJ20585-PA 26..331 27..336 300 30 Plus
Dvir\GJ11310-PA 328 GJ11310-PA 26..326 27..336 276 28.5 Plus
Dvir\GJ13554-PA 331 GJ13554-PA 7..329 2..336 260 25.7 Plus
Dvir\GJ14012-PA 327 GJ14012-PA 28..326 27..336 255 29.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17940-PA 335 GK17940-PA 1..335 1..339 1120 63.4 Plus
Dwil\GK17939-PA 335 GK17939-PA 1..335 1..339 1023 58.6 Plus
Dwil\GK17941-PA 332 GK17941-PA 1..332 1..339 1013 58.1 Plus
Dwil\GK22909-PA 370 GK22909-PA 57..357 23..326 233 26 Plus
Dwil\GK19626-PA 341 GK19626-PA 28..339 27..336 224 24.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:14:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13340-PA 342 GE13340-PA 3..342 1..340 1703 95.6 Plus
Dyak\GE10178-PA 336 GE10178-PA 12..322 1..326 256 26.3 Plus
Dyak\GE11675-PA 384 GE11675-PA 75..371 27..326 234 27.1 Plus
Dyak\GE12574-PA 341 GE12574-PA 26..339 25..336 233 25.7 Plus
Dyak\GE12565-PA 353 GE12565-PA 32..351 25..336 229 26.4 Plus