Clone RE20371 Report

Search the DGRC for RE20371

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:203
Well:71
Vector:pFlc-1
Associated Gene/TranscriptCG13912-RA
Protein status:RE20371.pep: gold
Preliminary Size:489
Sequenced Size:833

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13912 2002-01-01 Sim4 clustering to Release 2
CG13912 2003-01-01 Sim4 clustering to Release 3
CG13912 2005-05-03 Blastp of sequenced clone
CG13912 2008-04-29 Release 5.5 accounting
CG13912 2008-08-15 Release 5.9 accounting
CG13912 2008-12-18 5.12 accounting

Clone Sequence Records

RE20371.complete Sequence

833 bp (833 high quality bases) assembled on 2006-06-05

GenBank Submission: BT022087

> RE20371.complete
AGTTGGATTTCAGCAGCGGAGCAGACCAGTCGGTTCGCGATCAGTGCAAA
TAAACAGATCCACGTGCCGAGCATAGAAACTAGCCATTGAATACATCACC
AGATCGGCAATAAAACACGCAGTGACTGATAAGAGTGCAGGCAAAAAAAA
TAAAATAACAAATCAGATAGACAAAAATACGGCACTACGGATACAGGCAT
TTCTGAACAGCCAAGATGATGTCACATACTGTGAGGGTCTTCAAGATGAT
GTACATTGTGGCGGGCATCCTCATCAGCAATGCGGAGATCTGCGACACAG
TGGACCGCATCCAGATAGCGCCACGCGTCGACCTCAAGCCGGAATACGAT
CACAGGTACTTGACCTCCGGAGGCAATAGTCCCGGCTCCCGATCCCGCAC
CCACTCTCGACAGAATTCCGGAAGTGGATCCGGATCGGAGGAAGGATCCC
CCACCAAGAGGCGGAGAGTCAGCGTTTCCGGTATCGCGGGGGGCGTGGTC
AGGGGCGTCACTAGCCAGGTCACCAAGAGAGTGGGCCACCGCTTCGTCTG
GCTATCCGACATCCGGCTCATTCTCCGGCAATGGCGACTCCTGGCCCTCA
GCTTCAACCTCTGGACCATTCCCAACTTCTTGGTGCAGTGCCTCACCAGC
TACATGAGCAAGAAGCTGCTCATCAATAGCGACTGTGATATGATCTACAA
GTAGGATTAGGTTATGGGATATTGAGTAGTAGGACAGCGCACCGAGAGGT
TGCAATTTATTGTTACTTTAGTTTTTACATAGCTTTAAGATTTGAATAAA
CAACTGCTAGACATAGTAAAAAAAAAAAAAAAA

RE20371.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13912-RA 1085 CG13912-RA 239..1054 1..816 4080 100 Plus
Trh-RA 2331 Trh-RA 2243..2331 816..728 445 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 20:13:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 1189437..1190019 234..816 2900 99.8 Plus
chr3L 24539361 chr3L 1189137..1189372 1..236 1180 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 20:13:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 1189890..1190472 234..816 2915 100 Plus
3L 28110227 3L 1189590..1189825 1..236 1180 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 1189890..1190472 234..816 2915 100 Plus
3L 28103327 3L 1189590..1189825 1..236 1180 100 Plus
Blast to na_te.dros performed 2019-03-15 20:13:13
Subject Length Description Subject Range Query Range Score Percent Strand
297 6995 297 DMIS297 6995bp Derived from X03431 (g8146) (Rel. 36, Last updated, Version 2). 3145..3195 768..815 113 72.5 Plus

RE20371.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 20:14:20 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 1189137..1189371 1..235 100 -> Plus
chr3L 1189439..1190019 236..817 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:51 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..489 216..704 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:39 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..489 216..704 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 04:49:44 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..489 216..704 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:26 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..489 216..704 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:31:07 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..489 216..704 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:55 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..704 1..704 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:39 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..816 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 04:49:44 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 3..818 1..816 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:42:27 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 1..704 1..704 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:31:07 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
CG13912-RA 3..818 1..816 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:20 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1189590..1189824 1..235 100 -> Plus
3L 1189892..1190472 236..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:20 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1189590..1189824 1..235 100 -> Plus
3L 1189892..1190472 236..817 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 20:14:20 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1189590..1189824 1..235 100 -> Plus
3L 1189892..1190472 236..817 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 04:49:44 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 1189590..1189824 1..235 100 -> Plus
arm_3L 1189892..1190472 236..817 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:31 Download gff for RE20371.complete
Subject Subject Range Query Range Percent Splice Strand
3L 1189590..1189824 1..235 100 -> Plus
3L 1189892..1190472 236..817 99   Plus

RE20371.hyp Sequence

Translation from 215 to 703

> RE20371.hyp
MMSHTVRVFKMMYIVAGILISNAEICDTVDRIQIAPRVDLKPEYDHRYLT
SGGNSPGSRSRTHSRQNSGSGSGSEEGSPTKRRRVSVSGIAGGVVRGVTS
QVTKRVGHRFVWLSDIRLILRQWRLLALSFNLWTIPNFLVQCLTSYMSKK
LLINSDCDMIYK*

RE20371.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:13:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG13912-PA 162 CG13912-PA 1..162 1..162 837 100 Plus

RE20371.pep Sequence

Translation from 215 to 703

> RE20371.pep
MMSHTVRVFKMMYIVAGILISNAEICDTVDRIQIAPRVDLKPEYDHRYLT
SGGNSPGSRSRTHSRQNSGSGSGSEEGSPTKRRRVSVSGIAGGVVRGVTS
QVTKRVGHRFVWLSDIRLILRQWRLLALSFNLWTIPNFLVQCLTSYMSKK
LLINSDCDMIYK*

RE20371.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24432-PA 165 GF24432-PA 1..165 1..162 582 78.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:28:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14756-PA 159 GG14756-PA 1..159 1..162 782 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15821-PA 150 GH15821-PA 1..150 1..162 437 54.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG13912-PA 162 CG13912-PA 1..162 1..162 837 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:28:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12602-PA 149 GI12602-PA 1..149 1..162 460 57.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25404-PA 165 GL25404-PA 1..165 1..162 575 73.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:28:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12620-PA 165 GA12620-PA 1..165 1..162 579 72.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:28:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14375-PA 161 GM14375-PA 1..161 1..162 822 96.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13591-PA 162 GD13591-PA 1..162 1..162 846 98.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:28:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12725-PA 155 GJ12725-PA 1..155 1..162 453 57.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17330-PA 150 GK17330-PA 1..150 1..162 571 67.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:28:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21119-PA 162 GE21119-PA 1..162 1..162 827 94.4 Plus