Clone RE20389 Report

Search the DGRC for RE20389

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:203
Well:89
Vector:pFlc-1
Associated Gene/TranscriptCG10470-RA
Protein status:RE20389.pep: gold
Preliminary Size:633
Sequenced Size:711

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10470 2002-01-01 Sim4 clustering to Release 2
CG10470 2003-01-01 Sim4 clustering to Release 3
CG9233 2003-01-01 Sim4 clustering to Release 3
CG10470 2008-04-29 Release 5.5 accounting
CG10470 2008-08-15 Release 5.9 accounting
CG10470 2008-12-18 5.12 accounting

Clone Sequence Records

RE20389.complete Sequence

711 bp (711 high quality bases) assembled on 2006-06-05

GenBank Submission: BT023490

> RE20389.complete
AGTCCATGTTAATAAGCTATCGGAGCCGCTTAATGATTTATGTCAATAGT
GCTATCGATGAGTTTTAATTTGTATTAACATTAATTTAGTGAAAAAATGT
GGTCCGACACAATATTAATTGTTTTTATATCGGTTTGCACCGCCTTCCTG
GGCGAAGGTCTTACATGGGTGATGGTTTACCGGACGGAGAAGTACCAAAA
GCTAAAGACCGAGGTGGAAAAGCAGAGCAAAAAGCTGGAGCGCCGCAAGG
AAATCCATGGGGACTCCCTGGACAAAGCGGTAAAGAAGAAGATCGAGCGC
GACGAGGAAAAACTGAAAAACAACAACCGCGATCTCTCGCTTGTCAAGAT
GAAGACCATGTTCGCCACGGGATTCGCCTTCACCGCCCTGTTGAGTATGT
TCAACAGCATCTTCGACGGCCGTGTGGTTGCCCAGCTGCCCTTCACACCA
ATCTCCTGGATCCAGGGGTTAAGTCACCGAAATTTGTCCGGTGACGACTA
TACGGACTGCTCCTTTATATTCCTCTACATCCTGTGCACCATGTCCATTC
GTCAGAACATCCAAAAGCTTCTGGGTTTTGCCCCATCGCGCGCCGCAAGC
AAGCAGGGTGTAGGTCTGTTTGGTCCTGCTCCAGGCCAGTTCAAATAGTT
CAAATTCATTAATTAAATTGTTGCATTTAGTTTTAATGCACCATCAAAAA
AAAAAAAAAAA

RE20389.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 17:14:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG10470-RA 769 CG10470-RA 25..721 1..697 3485 100 Plus
CG10470.a 798 CG10470.a 209..750 156..697 2710 100 Plus
CG10470.a 798 CG10470.a 3..161 1..159 795 100 Plus
l(2)37Bb-RA 1712 l(2)37Bb-RA 1672..1712 697..657 205 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 11:09:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19048039..19048498 236..695 2285 99.8 Plus
chr2L 23010047 chr2L 19047696..19047854 1..159 780 99.4 Plus
chr2L 23010047 chr2L 19047902..19047981 156..235 400 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 11:09:37
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19049422..19049883 236..697 2310 100 Plus
2L 23513712 2L 19049079..19049237 1..159 795 100 Plus
2L 23513712 2L 19049285..19049364 156..235 400 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:07:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19049422..19049883 236..697 2310 100 Plus
2L 23513712 2L 19049079..19049237 1..159 795 100 Plus
2L 23513712 2L 19049285..19049364 156..235 400 100 Plus
Blast to na_te.dros performed on 2019-03-16 11:09:37 has no hits.

RE20389.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 11:10:27 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19048039..19048498 236..695 99   Plus
chr2L 19047696..19047852 1..157 99 -> Plus
chr2L 19047904..19047981 158..235 100 -> Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:00:53 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 15:23:41 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 10:08:24 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 15:42:29 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:29:12 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..552 97..648 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 17:51:57 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 15:23:41 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 10:08:24 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 4..698 1..695 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 15:42:29 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 1..695 1..695 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:29:12 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
CG10470-RA 4..698 1..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:27 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19049079..19049235 1..157 100 -> Plus
2L 19049287..19049364 158..235 100 -> Plus
2L 19049422..19049881 236..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:27 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19049079..19049235 1..157 100 -> Plus
2L 19049287..19049364 158..235 100 -> Plus
2L 19049422..19049881 236..695 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 11:10:27 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19049079..19049235 1..157 100 -> Plus
2L 19049287..19049364 158..235 100 -> Plus
2L 19049422..19049881 236..695 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 10:08:24 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19049079..19049235 1..157 100 -> Plus
arm_2L 19049287..19049364 158..235 100 -> Plus
arm_2L 19049422..19049881 236..695 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 12:51:33 Download gff for RE20389.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19049079..19049235 1..157 100 -> Plus
2L 19049287..19049364 158..235 100 -> Plus
2L 19049422..19049881 236..695 100   Plus

RE20389.pep Sequence

Translation from 96 to 647

> RE20389.pep
MWSDTILIVFISVCTAFLGEGLTWVMVYRTEKYQKLKTEVEKQSKKLERR
KEIHGDSLDKAVKKKIERDEEKLKNNNRDLSLVKMKTMFATGFAFTALLS
MFNSIFDGRVVAQLPFTPISWIQGLSHRNLSGDDYTDCSFIFLYILCTMS
IRQNIQKLLGFAPSRAASKQGVGLFGPAPGQFK*

RE20389.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:10:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14694-PA 183 GF14694-PA 1..183 1..183 966 98.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21153-PA 183 GG21153-PA 1..183 1..183 976 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:10:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10893-PA 183 GH10893-PA 1..183 1..183 918 92.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:17:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG10470-PA 183 CG10470-PA 1..183 1..183 944 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13086-PA 183 GI13086-PA 1..183 1..183 927 94 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:10:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26158-PA 183 GL26158-PA 1..183 1..183 941 96.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10334-PA 183 GA10334-PA 1..183 1..183 941 96.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:10:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17318-PA 183 GM17318-PA 1..183 1..183 976 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24177-PA 183 GD24177-PA 1..183 1..183 976 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:10:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11625-PA 183 GJ11625-PA 1..183 1..183 927 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24167-PA 183 GK24167-PA 1..183 1..183 963 97.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:10:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13226-PA 183 GE13226-PA 1..183 1..183 976 100 Plus

RE20389.hyp Sequence

Translation from 96 to 647

> RE20389.hyp
MWSDTILIVFISVCTAFLGEGLTWVMVYRTEKYQKLKTEVEKQSKKLERR
KEIHGDSLDKAVKKKIERDEEKLKNNNRDLSLVKMKTMFATGFAFTALLS
MFNSIFDGRVVAQLPFTPISWIQGLSHRNLSGDDYTDCSFIFLYILCTMS
IRQNIQKLLGFAPSRAASKQGVGLFGPAPGQFK*

RE20389.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:13:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG10470-PA 183 CG10470-PA 1..183 1..183 944 100 Plus