BDGP Sequence Production Resources |
Search the DGRC for RE20389
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 203 |
Well: | 89 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG10470-RA |
Protein status: | RE20389.pep: gold |
Preliminary Size: | 633 |
Sequenced Size: | 711 |
Gene | Date | Evidence |
---|---|---|
CG10470 | 2002-01-01 | Sim4 clustering to Release 2 |
CG10470 | 2003-01-01 | Sim4 clustering to Release 3 |
CG9233 | 2003-01-01 | Sim4 clustering to Release 3 |
CG10470 | 2008-04-29 | Release 5.5 accounting |
CG10470 | 2008-08-15 | Release 5.9 accounting |
CG10470 | 2008-12-18 | 5.12 accounting |
711 bp (711 high quality bases) assembled on 2006-06-05
GenBank Submission: BT023490
> RE20389.complete AGTCCATGTTAATAAGCTATCGGAGCCGCTTAATGATTTATGTCAATAGT GCTATCGATGAGTTTTAATTTGTATTAACATTAATTTAGTGAAAAAATGT GGTCCGACACAATATTAATTGTTTTTATATCGGTTTGCACCGCCTTCCTG GGCGAAGGTCTTACATGGGTGATGGTTTACCGGACGGAGAAGTACCAAAA GCTAAAGACCGAGGTGGAAAAGCAGAGCAAAAAGCTGGAGCGCCGCAAGG AAATCCATGGGGACTCCCTGGACAAAGCGGTAAAGAAGAAGATCGAGCGC GACGAGGAAAAACTGAAAAACAACAACCGCGATCTCTCGCTTGTCAAGAT GAAGACCATGTTCGCCACGGGATTCGCCTTCACCGCCCTGTTGAGTATGT TCAACAGCATCTTCGACGGCCGTGTGGTTGCCCAGCTGCCCTTCACACCA ATCTCCTGGATCCAGGGGTTAAGTCACCGAAATTTGTCCGGTGACGACTA TACGGACTGCTCCTTTATATTCCTCTACATCCTGTGCACCATGTCCATTC GTCAGAACATCCAAAAGCTTCTGGGTTTTGCCCCATCGCGCGCCGCAAGC AAGCAGGGTGTAGGTCTGTTTGGTCCTGCTCCAGGCCAGTTCAAATAGTT CAAATTCATTAATTAAATTGTTGCATTTAGTTTTAATGCACCATCAAAAA AAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10470-RA | 769 | CG10470-RA | 25..721 | 1..697 | 3485 | 100 | Plus |
CG10470.a | 798 | CG10470.a | 209..750 | 156..697 | 2710 | 100 | Plus |
CG10470.a | 798 | CG10470.a | 3..161 | 1..159 | 795 | 100 | Plus |
l(2)37Bb-RA | 1712 | l(2)37Bb-RA | 1672..1712 | 697..657 | 205 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 19048039..19048498 | 236..695 | 2285 | 99.8 | Plus |
chr2L | 23010047 | chr2L | 19047696..19047854 | 1..159 | 780 | 99.4 | Plus |
chr2L | 23010047 | chr2L | 19047902..19047981 | 156..235 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19049422..19049883 | 236..697 | 2310 | 100 | Plus |
2L | 23513712 | 2L | 19049079..19049237 | 1..159 | 795 | 100 | Plus |
2L | 23513712 | 2L | 19049285..19049364 | 156..235 | 400 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19049422..19049883 | 236..697 | 2310 | 100 | Plus |
2L | 23513712 | 2L | 19049079..19049237 | 1..159 | 795 | 100 | Plus |
2L | 23513712 | 2L | 19049285..19049364 | 156..235 | 400 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19048039..19048498 | 236..695 | 99 | Plus | |
chr2L | 19047696..19047852 | 1..157 | 99 | -> | Plus |
chr2L | 19047904..19047981 | 158..235 | 100 | -> | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..552 | 97..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..552 | 97..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..552 | 97..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..552 | 97..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..552 | 97..648 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..695 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..695 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 4..698 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 1..695 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG10470-RA | 4..698 | 1..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19049079..19049235 | 1..157 | 100 | -> | Plus |
2L | 19049287..19049364 | 158..235 | 100 | -> | Plus |
2L | 19049422..19049881 | 236..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19049079..19049235 | 1..157 | 100 | -> | Plus |
2L | 19049287..19049364 | 158..235 | 100 | -> | Plus |
2L | 19049422..19049881 | 236..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19049079..19049235 | 1..157 | 100 | -> | Plus |
2L | 19049287..19049364 | 158..235 | 100 | -> | Plus |
2L | 19049422..19049881 | 236..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19049079..19049235 | 1..157 | 100 | -> | Plus |
arm_2L | 19049287..19049364 | 158..235 | 100 | -> | Plus |
arm_2L | 19049422..19049881 | 236..695 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19049079..19049235 | 1..157 | 100 | -> | Plus |
2L | 19049287..19049364 | 158..235 | 100 | -> | Plus |
2L | 19049422..19049881 | 236..695 | 100 | Plus |
Translation from 96 to 647
> RE20389.pep MWSDTILIVFISVCTAFLGEGLTWVMVYRTEKYQKLKTEVEKQSKKLERR KEIHGDSLDKAVKKKIERDEEKLKNNNRDLSLVKMKTMFATGFAFTALLS MFNSIFDGRVVAQLPFTPISWIQGLSHRNLSGDDYTDCSFIFLYILCTMS IRQNIQKLLGFAPSRAASKQGVGLFGPAPGQFK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14694-PA | 183 | GF14694-PA | 1..183 | 1..183 | 966 | 98.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21153-PA | 183 | GG21153-PA | 1..183 | 1..183 | 976 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10893-PA | 183 | GH10893-PA | 1..183 | 1..183 | 918 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10470-PA | 183 | CG10470-PA | 1..183 | 1..183 | 944 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13086-PA | 183 | GI13086-PA | 1..183 | 1..183 | 927 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL26158-PA | 183 | GL26158-PA | 1..183 | 1..183 | 941 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA10334-PA | 183 | GA10334-PA | 1..183 | 1..183 | 941 | 96.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17318-PA | 183 | GM17318-PA | 1..183 | 1..183 | 976 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24177-PA | 183 | GD24177-PA | 1..183 | 1..183 | 976 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ11625-PA | 183 | GJ11625-PA | 1..183 | 1..183 | 927 | 94 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24167-PA | 183 | GK24167-PA | 1..183 | 1..183 | 963 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13226-PA | 183 | GE13226-PA | 1..183 | 1..183 | 976 | 100 | Plus |
Translation from 96 to 647
> RE20389.hyp MWSDTILIVFISVCTAFLGEGLTWVMVYRTEKYQKLKTEVEKQSKKLERR KEIHGDSLDKAVKKKIERDEEKLKNNNRDLSLVKMKTMFATGFAFTALLS MFNSIFDGRVVAQLPFTPISWIQGLSHRNLSGDDYTDCSFIFLYILCTMS IRQNIQKLLGFAPSRAASKQGVGLFGPAPGQFK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG10470-PA | 183 | CG10470-PA | 1..183 | 1..183 | 944 | 100 | Plus |