Clone RE20610 Report

Search the DGRC for RE20610

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:206
Well:10
Vector:pFlc-1
Associated Gene/TranscriptCG15717-RA
Protein status:RE20610.pep: gold
Preliminary Size:759
Sequenced Size:1169

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15717 2002-01-01 Sim4 clustering to Release 2
CG15717 2002-04-22 Blastp of sequenced clone
CG15717 2003-01-01 Sim4 clustering to Release 3
CG15717 2008-04-29 Release 5.5 accounting
CG15717 2008-08-15 Release 5.9 accounting
CG15717 2008-12-18 5.12 accounting

Clone Sequence Records

RE20610.complete Sequence

1169 bp (1169 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113424

> RE20610.complete
TGTGTGTGTATGTTTGCGTGAGCCGCTGATAACGCAGCTGATCGGGCGAT
TCCATTGAATTCAAGTTTTCAATTCGCAGAGCATGGCCAGCAACTTCACC
CAGTCCCAGCCGTCCAGGATCACCAGCTACATGGTCAACCAGCTGCAGCC
GACGGCGCAGGAAACGAAGTTGGCGCTGATTCCCAGTGCACCCCAGTGGC
GCTCCCCCCAGCTGATGGTCGTCTTCGAGGACGGTGATCTGCACTCAGCG
CGCCACCAGTTGCTCCAGTCCCTGCAGAATCCCTTTGCCGAGGGATCGGT
GGCCACGTTGCTACTCCAGGAGAGCATTGCCGATCAGTTTGTGGGCCTAG
TGGCGCAGGATTTGCGTCCGTTGTCGCAGGAGGTGTCCAAGCATCCGAGC
TACACCAGCACGCTGGCCAAGATCGAAGAGCTGAAGGCCAAGACAGTACA
AGGCGAAAGCCTTAAGGCTGGGGAATCACCCGTCTTGGTGTACGACTGCG
TGCACAGCTATCTGGGCAATGGAGCGACGGGAGTGGTGACGGTGCACACA
TTCCGCACAGCCAAGGAGGCCGGCCAGTTGGCCAAAAGGGATCCCCTACC
TTACGGCCAAGTTAGTCTGTGGAATGAGAAGCTGGGCTGCGCCTACGAAC
TGATACCACGACTACCGAGCGATATTGTGGCCATTAATTGCTTCAATCCG
GACTTGGATCCCATCTGGGAATCCTTTGCTGCCGACCGCAACGATGTTCT
GCTGGCCAAGAACTATCACTATGAATCGCTGGTGGTGAGCGGCAAACGGA
GGATCGTCGTCTTTCCCGTGGGCACCATCTTCGGCAACTGAAGAGTGACA
GTTCTGGACTTCGACGGCGACGAATCACATCCGGAAGGAATTACATCCAG
GTGCTTTTTAAGCCATACTTTAAAATACCTCTCTAAGCATTTTACATGTA
GCTTGGGGCATCCTTTTCGACAGTTCAATTGGAATTATATCGAACTAAAT
TAGGAGTTATGTCAAACAACTAGCATTTAATGTGGCTTAACTTAGAAATT
ATCTGATTTTGCAACCATCATAATATTCCAATTGTATTGCGAAAAGGTCC
TTGAGTCTGAATTGTTTTTTTGATACTCTGTCAATAATTGTCCACTGAAA
AATCAAAAAAAAAAAAAAA

RE20610.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG15717-RA 1464 CG15717-RA 105..1258 2..1155 5770 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 13020250..13021236 168..1154 4935 100 Plus
chrX 22417052 chrX 13019967..13020134 2..169 840 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:40:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 13129304..13130291 168..1155 4940 100 Plus
X 23542271 X 13129021..13129188 2..169 840 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:39
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 13137402..13138389 168..1155 4940 100 Plus
X 23527363 X 13137119..13137286 2..169 840 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:44:53 has no hits.

RE20610.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:45:56 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 13019989..13020134 24..169 100 -> Plus
chrX 13020252..13021236 170..1154 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:07 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 1..759 83..841 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:58:57 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 1..759 83..841 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:19:09 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RB 13..774 80..841 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:14 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 1..759 83..841 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:53:45 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 1..759 83..841 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:31 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 2..1154 2..1154 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:58:57 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 2..1154 2..1154 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:19:09 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 3..1156 1..1154 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:14 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 2..1154 2..1154 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:53:45 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
CG15717-RA 3..1156 1..1154 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:45:56 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
X 13129020..13129188 1..169 99 -> Plus
X 13129306..13130290 170..1154 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:45:56 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
X 13129020..13129188 1..169 99 -> Plus
X 13129306..13130290 170..1154 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:45:56 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
X 13129020..13129188 1..169 99 -> Plus
X 13129306..13130290 170..1154 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:19:09 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 13023053..13023221 1..169 99 -> Plus
arm_X 13023339..13024323 170..1154 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:20 Download gff for RE20610.complete
Subject Subject Range Query Range Percent Splice Strand
X 13137404..13138388 170..1154 100   Plus
X 13137118..13137286 1..169 99 -> Plus

RE20610.pep Sequence

Translation from 82 to 840

> RE20610.pep
MASNFTQSQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFED
GDLHSARHQLLQSLQNPFAEGSVATLLLQESIADQFVGLVAQDLRPLSQE
VSKHPSYTSTLAKIEELKAKTVQGESLKAGESPVLVYDCVHSYLGNGATG
VVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVA
INCFNPDLDPIWESFAADRNDVLLAKNYHYESLVVSGKRRIVVFPVGTIF
GN*

RE20610.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:28:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21319-PA 253 GF21319-PA 1..253 1..252 861 66.4 Plus
Dana\GF16130-PA 294 GF16130-PA 77..294 39..252 531 44.5 Plus
Dana\GF18368-PA 320 GF18368-PA 97..313 38..252 513 43.3 Plus
Dana\GF21501-PA 310 GF21501-PA 84..288 42..247 376 36.1 Plus
Dana\GF21434-PA 276 GF21434-PA 22..238 38..245 309 32.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17756-PA 256 GG17756-PA 1..256 1..252 1174 86.4 Plus
Dere\GG13512-PA 316 GG13512-PA 91..307 38..252 555 47.9 Plus
Dere\GG12073-PA 291 GG12073-PA 74..291 39..252 508 42.2 Plus
Dere\GG21350-PA 296 GG21350-PA 62..271 41..247 433 38.6 Plus
Dere\GG22833-PA 259 GG22833-PA 37..255 39..246 312 29.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:28:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12691-PA 274 GH12691-PA 1..274 1..252 560 42.2 Plus
Dgri\GH17535-PA 306 GH17535-PA 35..283 12..247 426 34.4 Plus
Dgri\GH10452-PA 306 GH10452-PA 35..283 12..247 424 34.4 Plus
Dgri\GH24176-PA 272 GH24176-PA 53..268 35..246 297 28.8 Plus
Dgri\GH17534-PA 176 GH17534-PA 1..153 94..247 291 35 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:30:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG15717-PE 252 CG15717-PE 1..252 1..252 1296 100 Plus
CG15717-PC 252 CG15717-PC 1..252 1..252 1296 100 Plus
CG15717-PA 252 CG15717-PA 1..252 1..252 1296 100 Plus
CG2336-PA 322 CG2336-PA 97..311 38..250 531 48.8 Plus
CG12516-PB 300 CG12516-PB 73..300 22..252 500 41.3 Plus
CG11634-PB 298 CG11634-PB 67..276 41..247 413 39 Plus
CG11634-PA 298 CG11634-PA 67..276 41..247 413 39 Plus
CG13539-PB 260 CG13539-PB 34..256 35..246 301 28.1 Plus
CG13539-PA 260 CG13539-PA 34..256 35..246 301 28.1 Plus
CG12637-PA 292 CG12637-PA 23..238 39..245 300 30.6 Plus
CG5623-PA 279 CG5623-PA 9..250 13..248 222 25.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16366-PA 282 GI16366-PA 24..282 10..252 533 40.5 Plus
Dmoj\GI17704-PA 335 GI17704-PA 105..313 43..248 353 33 Plus
Dmoj\GI22587-PA 272 GI22587-PA 36..252 39..252 301 29 Plus
Dmoj\GI15524-PA 271 GI15524-PA 55..266 38..246 289 29.7 Plus
Dmoj\GI14293-PA 252 GI14293-PA 18..237 35..245 283 30.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14951-PA 265 GL14951-PA 16..265 9..252 747 58.2 Plus
Dper\GL21758-PA 320 GL21758-PA 86..301 38..251 572 49.1 Plus
Dper\GL23868-PA 301 GL23868-PA 86..301 39..252 552 45.8 Plus
Dper\GL25661-PA 286 GL25661-PA 51..261 40..246 370 34.1 Plus
Dper\GL21165-PA 280 GL21165-PA 52..274 35..246 315 29.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:28:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13910-PA 265 GA13910-PA 16..265 9..252 735 58.2 Plus
Dpse\GA26390-PA 320 GA26390-PA 86..301 38..251 566 48.6 Plus
Dpse\GA11672-PA 301 GA11672-PA 76..301 22..252 544 43.3 Plus
Dpse\GA11111-PA 322 GA11111-PA 87..297 40..246 384 35.1 Plus
Dpse\GA27755-PA 322 GA27755-PA 87..297 40..246 366 34.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11602-PA 252 GM11602-PA 1..252 1..252 1255 94.4 Plus
Dsec\GM10901-PA 319 GM10901-PA 94..309 38..251 552 47.2 Plus
Dsec\GM16298-PA 291 GM16298-PA 74..291 39..252 525 43.1 Plus
Dsec\GM16149-PA 298 GM16149-PA 67..276 41..247 410 38.1 Plus
Dsec\GM11293-PA 292 GM11293-PA 23..242 39..249 303 29.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD17100-PA 252 GD17100-PA 1..252 1..252 1235 93.3 Plus
Dsim\GD19880-PA 321 GD19880-PA 96..311 38..251 559 48.6 Plus
Dsim\GD18037-PA 300 GD18037-PA 74..300 23..252 527 41.9 Plus
Dsim\GD24338-PA 298 GD24338-PA 67..276 41..247 409 38.1 Plus
Dsim\GD16020-PA 292 GD16020-PA 23..238 39..245 300 29.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16736-PA 280 GJ16736-PA 14..280 3..252 618 45.9 Plus
Dvir\GJ13210-PA 254 GJ13210-PA 39..252 39..250 535 46.7 Plus
Dvir\GJ11430-PA 333 GJ11430-PA 102..310 42..247 373 34 Plus
Dvir\GJ19350-PA 246 GJ19350-PA 18..237 35..245 287 31.4 Plus
Dvir\GJ10307-PA 272 GJ10307-PA 36..250 39..250 285 30.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:28:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17389-PA 299 GK17389-PA 54..299 3..252 699 52.6 Plus
Dwil\GK24553-PA 296 GK24553-PA 65..296 21..252 593 47.9 Plus
Dwil\GK11577-PA 271 GK11577-PA 53..270 39..252 484 39.4 Plus
Dwil\GK18716-PA 274 GK18716-PA 38..250 41..246 423 38.5 Plus
Dwil\GK11680-PA 275 GK11680-PA 36..246 39..245 302 31.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:28:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17046-PA 253 GE17046-PA 1..253 1..252 1171 86.2 Plus
Dyak\GE10227-PA 323 GE10227-PA 100..316 38..252 541 46.1 Plus
Dyak\GE10517-PA 273 GE10517-PA 81..273 39..252 442 38.7 Plus
Dyak\GE12931-PA 297 GE12931-PA 27..275 8..247 425 35.3 Plus
Dyak\GE14269-PA 266 GE14269-PA 34..256 35..246 311 29.9 Plus

RE20610.hyp Sequence

Translation from 82 to 840

> RE20610.hyp
MASNFTQSQPSRITSYMVNQLQPTAQETKLALIPSAPQWRSPQLMVVFED
GDLHSARHQLLQSLQNPFAEGSVATLLLQESIADQFVGLVAQDLRPLSQE
VSKHPSYTSTLAKIEELKAKTVQGESLKAGESPVLVYDCVHSYLGNGATG
VVTVHTFRTAKEAGQLAKRDPLPYGQVSLWNEKLGCAYELIPRLPSDIVA
INCFNPDLDPIWESFAADRNDVLLAKNYHYESLVVSGKRRIVVFPVGTIF
GN*

RE20610.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15717-PE 252 CG15717-PE 1..252 1..252 1296 100 Plus
CG15717-PC 252 CG15717-PC 1..252 1..252 1296 100 Plus
CG15717-PA 252 CG15717-PA 1..252 1..252 1296 100 Plus
CG2336-PA 322 CG2336-PA 97..311 38..250 531 48.8 Plus
CG12516-PB 300 CG12516-PB 73..300 22..252 500 41.3 Plus