Clone RE20777 Report

Search the DGRC for RE20777

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:207
Well:77
Vector:pFlc-1
Associated Gene/Transcriptmms4-RA
Protein status:RE20777.pep: gold
Preliminary Size:930
Sequenced Size:1142

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12936 2002-01-01 Sim4 clustering to Release 2
CG12936 2002-06-10 Blastp of sequenced clone
CG12936 2003-01-01 Sim4 clustering to Release 3
CG12936 2008-04-29 Release 5.5 accounting
CG12936 2008-08-15 Release 5.9 accounting
CG12936 2008-12-18 5.12 accounting

Clone Sequence Records

RE20777.complete Sequence

1142 bp (1142 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071164

> RE20777.complete
GTTTAGAATATTTGGCGGACTTTTGTACACAATGTCAAATAAAGTGGACA
AGCTGCACAAGCAGGCTTTACGCGAACAACAGAAGCGTATTAAGCCCGGA
GAATGTATGAAATATGTGCGGATGGTCATAGATGCCGGATTTCTGGGCAT
TCCCGTGGGCCAGGAGGCACTGCAGCAATTGAATGCGACGGGTTTGAAGT
ATGAAATAAGGAGCTTGCCCGTGAGCCACTGCATCCTGTGGGAACGCAAT
GTTGGCCAGCAGACGATTGCTCTGGGCAGCAGTCCCACCGGCCTAGATGA
AGCCTGGAAATCGGAAAACCAAGTGGTCCAGTGGCTATCCGAAAGCAGCT
TCCAACGGGCTGTAAAGGATCAAAGTCTAGTTTGCCTGGGACCGCGCTTG
CAGGACTCATTTCCGGACTGCCAGTACACCATTGCCCTGCCAACGCTCCG
TCACAGCAAGCATGGCAGCTCATCCAGCCAGGACGCTCTGATTGAGATGC
AGTTGCTCCAGGAGCTACACGTGGAACAGCTAGATCAACCCGAAAGCCAG
GATCTAGTGGCCCTGCTGCAGCGCTATACAAAAGCAATAGCCGAAGCCCC
CTATAAGAAGCAACGCAACGAGACATTGGGAGGCTTCAAGAAATACCTGG
CCAACGACAAGAAGCAGTGCGTCCGTGTGGATCAGGGAAACGGATACGGA
AGACTCTGGCAGCAGCATCTGAATCGACTGCCAATGGTCACGCTGGAAGT
GGCCGAGTCCATAATAGCGCAGTATCCCTGTCCCAAGAAACTGATCGATC
ATTTCTCCAGCGATCCACTGGCTGTCCAAAGTCTCGCCGATTTGAAGATC
AAGCGATGCAATGGACCACAGCCTCTTCACACCGAGCGACGTATTGGAAA
TGTTCTCAGCAACAAACTGTATACATTGTATACTGCCAAGGATCCCAATA
CTCTAATTTAGAAAACTAAACTAAACTTTCTTAGCTTTAGAATCTGCTCA
TATATTAGCTTCCTAAAGTATGTACAATTATAATTAGGTTTTAAGTTAAG
ATCTAAGTATTTTACATTATTTTCTCATCGTATAAGGTATAATTTTAAAA
ATCACAATGTTCCTATACACATAAAAAAAAAAAAAAAAAAAA

RE20777.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
mms4-RA 1131 mms4-RA 4..1124 4..1124 5605 100 Plus
CG12341-RA 1247 CG12341-RA 1110..1247 1124..987 690 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6698634..6699752 4..1122 5505 99.5 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:03 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10811097..10812217 4..1124 5605 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10812296..10813416 4..1124 5605 100 Plus
Blast to na_te.dros performed 2019-03-16 22:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dbif\P-element_O 2986 Dbif\P-element_O P_O 2986bp Derived from X71634. 2636..2766 1088..954 162 59.3 Minus

RE20777.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:39:38 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6698631..6699752 1..1122 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:14 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12936-RA 1..930 32..961 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:08 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 1..930 32..961 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:15:49 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 1..930 32..961 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:41 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12936-RA 1..930 32..961 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:13 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 1..930 32..961 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:52 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12936-RA 1..1122 1..1122 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:08 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 1..1122 1..1122 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:15:49 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 17..1138 1..1122 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:41 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
CG12936-RA 1..1122 1..1122 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:13 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
mms4-RA 17..1138 1..1122 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:38 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10811094..10812215 1..1122 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:38 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10811094..10812215 1..1122 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:38 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10811094..10812215 1..1122 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:15:49 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6698599..6699720 1..1122 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:50 Download gff for RE20777.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10812293..10813414 1..1122 99   Plus

RE20777.hyp Sequence

Translation from 0 to 960

> RE20777.hyp
YRIFGGLLYTMSNKVDKLHKQALREQQKRIKPGECMKYVRMVIDAGFLGI
PVGQEALQQLNATGLKYEIRSLPVSHCILWERNVGQQTIALGSSPTGLDE
AWKSENQVVQWLSESSFQRAVKDQSLVCLGPRLQDSFPDCQYTIALPTLR
HSKHGSSSSQDALIEMQLLQELHVEQLDQPESQDLVALLQRYTKAIAEAP
YKKQRNETLGGFKKYLANDKKQCVRVDQGNGYGRLWQQHLNRLPMVTLEV
AESIIAQYPCPKKLIDHFSSDPLAVQSLADLKIKRCNGPQPLHTERRIGN
VLSNKLYTLYTAKDPNTLI*

RE20777.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:31:00
Subject Length Description Subject Range Query Range Score Percent Strand
mms4-PA 309 CG12936-PA 1..309 11..319 1609 100 Plus

RE20777.pep Sequence

Translation from 31 to 960

> RE20777.pep
MSNKVDKLHKQALREQQKRIKPGECMKYVRMVIDAGFLGIPVGQEALQQL
NATGLKYEIRSLPVSHCILWERNVGQQTIALGSSPTGLDEAWKSENQVVQ
WLSESSFQRAVKDQSLVCLGPRLQDSFPDCQYTIALPTLRHSKHGSSSSQ
DALIEMQLLQELHVEQLDQPESQDLVALLQRYTKAIAEAPYKKQRNETLG
GFKKYLANDKKQCVRVDQGNGYGRLWQQHLNRLPMVTLEVAESIIAQYPC
PKKLIDHFSSDPLAVQSLADLKIKRCNGPQPLHTERRIGNVLSNKLYTLY
TAKDPNTLI*

RE20777.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:50:23
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13776-PA 305 GF13776-PA 1..305 1..309 1301 79 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20149-PA 309 GG20149-PA 1..309 1..309 1562 94.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21271-PA 303 GH21271-PA 1..303 1..309 971 65.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
mms4-PA 309 CG12936-PA 1..309 1..309 1609 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20397-PA 306 GI20397-PA 1..306 1..309 1146 68.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:50:25
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17307-PA 309 GL17307-PA 1..309 1..309 1201 76.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11922-PA 309 GA11922-PA 1..309 1..309 1197 76.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21238-PA 309 GM21238-PA 1..309 1..309 1606 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10756-PA 309 GD10756-PA 1..309 1..309 1592 95.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22227-PA 309 GJ22227-PA 1..309 1..309 1086 68.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19664-PA 291 GK19664-PA 5..291 3..309 846 53.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:50:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12838-PA 309 GE12838-PA 1..309 1..309 1508 90.9 Plus