Clone RE20862 Report

Search the DGRC for RE20862

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:208
Well:62
Vector:pFlc-1
Associated Gene/Transcriptl(2)06225-RA
Protein status:RE20862.pep: gold
Sequenced Size:488

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6105 2001-12-14 Blastp of sequenced clone
CG6105 2002-01-01 Sim4 clustering to Release 2
l(2)06225 2008-04-29 Release 5.5 accounting
l(2)06225 2008-08-15 Release 5.9 accounting
l(2)06225 2008-12-18 5.12 accounting

Clone Sequence Records

RE20862.complete Sequence

488 bp (488 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071165

> RE20862.complete
GGTTAACATCTCTGTTTCGTCGCACACTGAATAGAACCAAATTGAAAAGA
TGGCGAGTTTGGCTACCAAGGGATCAGGACTTGTGAACAGGCTCCTCACA
CAGGCGAGGCCCCAACTGGACGTGTTCCTGAAGTACGCCAAGGTGGAACT
GACGCCCCCGACGCCCGCCGATATTCCGGCCATTCGCCAAGGACTGGGCA
ACATCATCAAGGGAGCCAAGACCGGCGCCTACAAGAACCTCACGGTTCGC
GAGGCCTGGCTTAACACCCTGGTGACCGCCGAGGTCATCTTCTGGTTCTA
CATCGGCGAGTGCATCGGCAAGCGTCACATTGTAGGCTACAATGTCTAAG
CTTACTATAGTCTCCGCTTGGCAGTCACTGGAATGGGCAACGTAATCCCT
AACAGATGTGTATATTTATATGTCTGCGAACATTTCGACTCTGAATAAAG
TGAAATAGTAATTTAAAATTCCAAAAAAAAAAAAAAAA

RE20862.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-RB 819 l(2)06225-RB 90..563 4..477 2355 99.7 Plus
l(2)06225-RC 1100 l(2)06225-RC 388..861 4..477 2355 99.7 Plus
l(2)06225-RA 830 l(2)06225-RA 130..574 33..477 2210 99.7 Plus
l(2)06225-RA 830 l(2)06225-RA 45..75 4..34 155 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 10974534..10974916 472..90 1915 100 Minus
chr2L 23010047 chr2L 10975005..10975062 90..33 290 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975774..10976161 477..90 1925 99.7 Minus
2L 23513712 2L 10976250..10976307 90..33 290 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:29
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 10975774..10976161 477..90 1925 99.7 Minus
2L 23513712 2L 10976250..10976307 90..33 290 100 Minus
2L 23513712 2L 10976362..10976392 34..4 155 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:38:47 has no hits.

RE20862.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:40:00 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 10974534..10974916 90..472 100 <- Minus
chr2L 10975006..10975060 35..89 100 <- Minus
chr2L 10975117..10975150 1..34 94   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:19 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 1..300 50..349 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:18 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 1..300 50..349 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:18 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 1..300 50..349 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:33 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 1..300 50..349 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:42 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RA 1..300 50..349 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:37:10 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 385..856 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:18 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 385..856 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:18 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RB 5..476 1..472 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:33 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RC 385..856 1..472 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:42 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)06225-RB 5..476 1..472 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:00 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10975779..10976161 90..472 100 <- Minus
2L 10976251..10976305 35..89 100 <- Minus
2L 10976362..10976395 1..34 94   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:00 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10975779..10976161 90..472 100 <- Minus
2L 10976251..10976305 35..89 100 <- Minus
2L 10976362..10976395 1..34 94   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:00 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10975779..10976161 90..472 100 <- Minus
2L 10976251..10976305 35..89 100 <- Minus
2L 10976362..10976395 1..34 94   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:18 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 10975779..10976161 90..472 100 <- Minus
arm_2L 10976251..10976305 35..89 100 <- Minus
arm_2L 10976362..10976395 1..34 94   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:29 Download gff for RE20862.complete
Subject Subject Range Query Range Percent Splice Strand
2L 10975779..10976161 90..472 100 <- Minus
2L 10976251..10976305 35..89 100 <- Minus
2L 10976362..10976395 1..34 94   Minus

RE20862.hyp Sequence

Translation from 49 to 348

> RE20862.hyp
MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG
NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV*

RE20862.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:33:15
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)06225-PD 99 CG6105-PD 1..99 1..99 512 100 Plus
l(2)06225-PB 99 CG6105-PB 1..99 1..99 512 100 Plus
l(2)06225-PA 99 CG6105-PA 1..99 1..99 512 100 Plus
CG7211-PA 107 CG7211-PA 1..107 1..99 261 51.4 Plus

RE20862.pep Sequence

Translation from 49 to 348

> RE20862.pep
MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG
NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV*

RE20862.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:00:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14048-PA 99 GF14048-PA 1..99 1..99 518 100 Plus
Dana\GF15319-PA 109 GF15319-PA 1..109 1..99 260 49.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG10338-PA 99 GG10338-PA 1..99 1..99 512 99 Plus
Dere\GG10491-PA 107 GG10491-PA 1..107 1..99 276 49.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:00:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10969-PA 99 GH10969-PA 1..99 1..99 481 87.9 Plus
Dgri\GH11258-PA 101 GH11258-PA 1..101 1..99 280 53.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:27
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsynG-PD 99 CG6105-PD 1..99 1..99 512 100 Plus
ATPsynG-PB 99 CG6105-PB 1..99 1..99 512 100 Plus
ATPsynG-PA 99 CG6105-PA 1..99 1..99 512 100 Plus
ATPsynGL-PA 107 CG7211-PA 1..107 1..99 261 51.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18153-PA 99 GI18153-PA 1..99 1..99 478 88.9 Plus
Dmoj\GI21888-PA 97 GI21888-PA 1..97 1..99 227 47.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:00:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19020-PA 99 GL19020-PA 1..99 1..99 501 93.9 Plus
Dper\GL19281-PA 104 GL19281-PA 20..104 20..99 223 54.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19355-PA 99 GA19355-PA 1..99 1..99 501 93.9 Plus
Dpse\GA24948-PA 68 GA24948-PA 1..68 18..84 240 67.6 Plus
Dpse\GA20182-PA 104 GA20182-PA 20..104 20..99 222 53.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:00:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11242-PA 99 GM11242-PA 1..99 1..99 518 100 Plus
Dsec\GM16543-PA 107 GM16543-PA 1..107 1..99 263 51.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22207-PA 99 GD22207-PA 1..99 1..99 518 100 Plus
Dsim\GD23483-PA 107 GD23483-PA 1..107 1..99 273 52.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:00:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14568-PA 99 GJ14568-PA 1..99 1..99 484 87.9 Plus
Dvir\GJ17810-PA 105 GJ17810-PA 1..105 1..99 285 56.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15246-PA 98 GK15246-PA 1..98 1..99 448 87.9 Plus
Dwil\GK24404-PA 105 GK24404-PA 1..105 1..99 300 54.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:00:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\l(2)06225-PA 99 GE13121-PA 1..99 1..99 518 100 Plus
Dyak\GE14603-PA 107 GE14603-PA 1..107 1..99 261 50.5 Plus