BDGP Sequence Production Resources |
Search the DGRC for RE20862
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 208 |
Well: | 62 |
Vector: | pFlc-1 |
Associated Gene/Transcript | l(2)06225-RA |
Protein status: | RE20862.pep: gold |
Sequenced Size: | 488 |
Gene | Date | Evidence |
---|---|---|
CG6105 | 2001-12-14 | Blastp of sequenced clone |
CG6105 | 2002-01-01 | Sim4 clustering to Release 2 |
l(2)06225 | 2008-04-29 | Release 5.5 accounting |
l(2)06225 | 2008-08-15 | Release 5.9 accounting |
l(2)06225 | 2008-12-18 | 5.12 accounting |
488 bp (488 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071165
> RE20862.complete GGTTAACATCTCTGTTTCGTCGCACACTGAATAGAACCAAATTGAAAAGA TGGCGAGTTTGGCTACCAAGGGATCAGGACTTGTGAACAGGCTCCTCACA CAGGCGAGGCCCCAACTGGACGTGTTCCTGAAGTACGCCAAGGTGGAACT GACGCCCCCGACGCCCGCCGATATTCCGGCCATTCGCCAAGGACTGGGCA ACATCATCAAGGGAGCCAAGACCGGCGCCTACAAGAACCTCACGGTTCGC GAGGCCTGGCTTAACACCCTGGTGACCGCCGAGGTCATCTTCTGGTTCTA CATCGGCGAGTGCATCGGCAAGCGTCACATTGTAGGCTACAATGTCTAAG CTTACTATAGTCTCCGCTTGGCAGTCACTGGAATGGGCAACGTAATCCCT AACAGATGTGTATATTTATATGTCTGCGAACATTTCGACTCTGAATAAAG TGAAATAGTAATTTAAAATTCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(2)06225-RB | 819 | l(2)06225-RB | 90..563 | 4..477 | 2355 | 99.7 | Plus |
l(2)06225-RC | 1100 | l(2)06225-RC | 388..861 | 4..477 | 2355 | 99.7 | Plus |
l(2)06225-RA | 830 | l(2)06225-RA | 130..574 | 33..477 | 2210 | 99.7 | Plus |
l(2)06225-RA | 830 | l(2)06225-RA | 45..75 | 4..34 | 155 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 10975774..10976161 | 477..90 | 1925 | 99.7 | Minus |
2L | 23513712 | 2L | 10976250..10976307 | 90..33 | 290 | 100 | Minus |
2L | 23513712 | 2L | 10976362..10976392 | 34..4 | 155 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 10974534..10974916 | 90..472 | 100 | <- | Minus |
chr2L | 10975006..10975060 | 35..89 | 100 | <- | Minus |
chr2L | 10975117..10975150 | 1..34 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 1..300 | 50..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 1..300 | 50..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RA | 1..300 | 50..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 1..300 | 50..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RA | 1..300 | 50..349 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 385..856 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 385..856 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RB | 5..476 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RC | 385..856 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)06225-RB | 5..476 | 1..472 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10975779..10976161 | 90..472 | 100 | <- | Minus |
2L | 10976251..10976305 | 35..89 | 100 | <- | Minus |
2L | 10976362..10976395 | 1..34 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10975779..10976161 | 90..472 | 100 | <- | Minus |
2L | 10976251..10976305 | 35..89 | 100 | <- | Minus |
2L | 10976362..10976395 | 1..34 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10975779..10976161 | 90..472 | 100 | <- | Minus |
2L | 10976251..10976305 | 35..89 | 100 | <- | Minus |
2L | 10976362..10976395 | 1..34 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 10975779..10976161 | 90..472 | 100 | <- | Minus |
arm_2L | 10976251..10976305 | 35..89 | 100 | <- | Minus |
arm_2L | 10976362..10976395 | 1..34 | 94 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 10975779..10976161 | 90..472 | 100 | <- | Minus |
2L | 10976251..10976305 | 35..89 | 100 | <- | Minus |
2L | 10976362..10976395 | 1..34 | 94 | Minus |
Translation from 49 to 348
> RE20862.hyp MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(2)06225-PD | 99 | CG6105-PD | 1..99 | 1..99 | 512 | 100 | Plus |
l(2)06225-PB | 99 | CG6105-PB | 1..99 | 1..99 | 512 | 100 | Plus |
l(2)06225-PA | 99 | CG6105-PA | 1..99 | 1..99 | 512 | 100 | Plus |
CG7211-PA | 107 | CG7211-PA | 1..107 | 1..99 | 261 | 51.4 | Plus |
Translation from 49 to 348
> RE20862.pep MASLATKGSGLVNRLLTQARPQLDVFLKYAKVELTPPTPADIPAIRQGLG NIIKGAKTGAYKNLTVREAWLNTLVTAEVIFWFYIGECIGKRHIVGYNV*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14048-PA | 99 | GF14048-PA | 1..99 | 1..99 | 518 | 100 | Plus |
Dana\GF15319-PA | 109 | GF15319-PA | 1..109 | 1..99 | 260 | 49.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG10338-PA | 99 | GG10338-PA | 1..99 | 1..99 | 512 | 99 | Plus |
Dere\GG10491-PA | 107 | GG10491-PA | 1..107 | 1..99 | 276 | 49.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10969-PA | 99 | GH10969-PA | 1..99 | 1..99 | 481 | 87.9 | Plus |
Dgri\GH11258-PA | 101 | GH11258-PA | 1..101 | 1..99 | 280 | 53.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsynG-PD | 99 | CG6105-PD | 1..99 | 1..99 | 512 | 100 | Plus |
ATPsynG-PB | 99 | CG6105-PB | 1..99 | 1..99 | 512 | 100 | Plus |
ATPsynG-PA | 99 | CG6105-PA | 1..99 | 1..99 | 512 | 100 | Plus |
ATPsynGL-PA | 107 | CG7211-PA | 1..107 | 1..99 | 261 | 51.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18153-PA | 99 | GI18153-PA | 1..99 | 1..99 | 478 | 88.9 | Plus |
Dmoj\GI21888-PA | 97 | GI21888-PA | 1..97 | 1..99 | 227 | 47.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19020-PA | 99 | GL19020-PA | 1..99 | 1..99 | 501 | 93.9 | Plus |
Dper\GL19281-PA | 104 | GL19281-PA | 20..104 | 20..99 | 223 | 54.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19355-PA | 99 | GA19355-PA | 1..99 | 1..99 | 501 | 93.9 | Plus |
Dpse\GA24948-PA | 68 | GA24948-PA | 1..68 | 18..84 | 240 | 67.6 | Plus |
Dpse\GA20182-PA | 104 | GA20182-PA | 20..104 | 20..99 | 222 | 53.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11242-PA | 99 | GM11242-PA | 1..99 | 1..99 | 518 | 100 | Plus |
Dsec\GM16543-PA | 107 | GM16543-PA | 1..107 | 1..99 | 263 | 51.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22207-PA | 99 | GD22207-PA | 1..99 | 1..99 | 518 | 100 | Plus |
Dsim\GD23483-PA | 107 | GD23483-PA | 1..107 | 1..99 | 273 | 52.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ14568-PA | 99 | GJ14568-PA | 1..99 | 1..99 | 484 | 87.9 | Plus |
Dvir\GJ17810-PA | 105 | GJ17810-PA | 1..105 | 1..99 | 285 | 56.2 | Plus |