Clone RE21095 Report

Search the DGRC for RE21095

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:210
Well:95
Vector:pFlc-1
Associated Gene/TranscriptGstE6-RA
Protein status:RE21095.pep: gold
Preliminary Size:669
Sequenced Size:775

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17530 2002-01-01 Sim4 clustering to Release 2
CG17530 2002-06-10 Blastp of sequenced clone
CG17530 2003-01-01 Sim4 clustering to Release 3
GstE6 2008-04-29 Release 5.5 accounting
GstE6 2008-08-15 Release 5.9 accounting
GstE6 2008-12-18 5.12 accounting

Clone Sequence Records

RE21095.complete Sequence

775 bp (775 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071166

> RE21095.complete
AGTTTGAAAAGAGACCCCACAGCGACAAGATGGTGAAATTGACTTTATAC
GGTTTGGACCCCAGTCCCCCAGTTCGCGCTGTTAAGCTTACTTTGGCCGC
TCTAAACCTAACCTACGAATATGTAAACGTTGACATTGTGGCTCGTGCCC
AACTTTCACCGGAATATCTGGAGAAGAATCCACAGCATACGGTGCCCACC
CTGGAGGATGACGGTCACTACATCTGGGATTCGCATGCCATTATTGCCTA
TTTGGTCTCGAAATATGCCGATTCCGATGCCCTATACCCGAAAGATCCTC
TCAAGCGGGCTGTTGTGGATCAGCGGCTGCACTTTGAATCCGGAGTGGTC
TTTGCCAATGGCATAAGGAGCATATCGAAGTCAGTGCTCTTCCAGGGACA
GACGAAAGTACCCAAGGAGCGATACGATGCCATTATCGAGATCTACGATT
TTGTGGAAACTTTTCTCAAGGGACAGGATTACATTGCTGGCAATCAACTG
ACCATTGCGGATTTCAGTCTCGTTTCATCGGTGGCCTCCCTTGAGGCCTT
CGTGGCCTTGGATACGACTAAGTATCCCAGGATCGGTGCTTGGATCAAAA
AGCTGGAACAGCTTCCATACTACGAGGAAGCCAATGGCAAGGGCGTCCGC
CAGTTGGTGGCCATTTTCAAGAAGACCAATTTCACATTCGAAGCATGATA
TTATTTTACAGTTTATATAGTCACAATAAATAATTGCTTAGAAAACTCTA
AAAAAACAAAAAAAAAAAAAAAAAA

RE21095.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:31
Subject Length Description Subject Range Query Range Score Percent Strand
GstE6-RA 753 GstE6-RA 1..750 1..750 3750 100 Plus
GstE5-RA 719 GstE5-RA 15..349 30..364 580 78.2 Plus
GstE5-RA 719 GstE5-RA 396..569 411..584 285 77.5 Plus
GstE7-RA 754 GstE7-RA 158..256 167..265 285 85.8 Plus
GstE7-RA 754 GstE7-RA 279..351 288..360 170 82.1 Plus
GstE7-RA 754 GstE7-RA 480..631 489..640 160 73.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:00:18
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 14293030..14293779 1..750 3750 100 Plus
chr2R 21145070 chr2R 14291677..14292332 30..685 775 74.5 Plus
chr2R 21145070 chr2R 14294109..14294582 167..640 480 73.4 Plus
chr2R 21145070 chr2R 14295023..14295371 173..521 350 73.4 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 18406013..18406762 1..750 3750 100 Plus
2R 25286936 2R 18404634..18405289 30..685 790 74.7 Plus
2R 25286936 2R 18407092..18407565 167..640 480 73.4 Plus
2R 25286936 2R 18408003..18408344 173..514 390 74.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:16
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 18407212..18407961 1..750 3750 100 Plus
2R 25260384 2R 18405833..18406167 30..364 580 78.2 Plus
2R 25260384 2R 18406214..18406387 411..584 285 77.5 Plus
2R 25260384 2R 18408291..18408389 167..265 285 85.8 Plus
2R 25260384 2R 18409202..18409387 173..358 270 76.3 Plus
2R 25260384 2R 18409440..18409543 411..514 250 82.6 Plus
2R 25260384 2R 18408412..18408484 288..360 170 82.1 Plus
2R 25260384 2R 18408613..18408764 489..640 160 73.6 Plus
2R 25260384 2R 18404616..18404700 172..256 155 78.8 Plus
Blast to na_te.dros performed on 2019-03-16 12:00:16 has no hits.

RE21095.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:01:00 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 14293030..14293779 1..750 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:27 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..669 30..698 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:25:09 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..669 30..698 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:46:15 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..669 30..698 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:42 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..669 30..698 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:33:42 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..669 30..698 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:54 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..753 1..753 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:25:09 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..749 1..749 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:46:15 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 3..751 1..749 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:42 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 1..753 1..753 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:33:42 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
GstE6-RA 3..751 1..749 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:00 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18406013..18406762 1..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:00 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18406013..18406762 1..750 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:00 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18406013..18406762 1..750 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:46:15 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14293518..14294267 1..750 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:51 Download gff for RE21095.complete
Subject Subject Range Query Range Percent Splice Strand
2R 18407212..18407961 1..750 100   Plus

RE21095.hyp Sequence

Translation from 2 to 697

> RE21095.hyp
FEKRPHSDKMVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQ
LSPEYLEKNPQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPL
KRAVVDQRLHFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDF
VETFLKGQDYIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKK
LEQLPYYEEANGKGVRQLVAIFKKTNFTFEA*

RE21095.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:26:59
Subject Length Description Subject Range Query Range Score Percent Strand
GstE6-PA 222 CG17530-PA 1..222 10..231 1134 100 Plus
GstE5-PA 222 CG17527-PA 1..220 10..229 884 75.5 Plus
GstE8-PB 222 CG17533-PB 1..220 10..229 831 70.5 Plus
GstE8-PA 222 CG17533-PA 1..220 10..229 831 70.5 Plus
GstE7-PA 223 CG17531-PA 1..220 10..229 826 70 Plus

RE21095.pep Sequence

Translation from 29 to 697

> RE21095.pep
MVKLTLYGLDPSPPVRAVKLTLAALNLTYEYVNVDIVARAQLSPEYLEKN
PQHTVPTLEDDGHYIWDSHAIIAYLVSKYADSDALYPKDPLKRAVVDQRL
HFESGVVFANGIRSISKSVLFQGQTKVPKERYDAIIEIYDFVETFLKGQD
YIAGNQLTIADFSLVSSVASLEAFVALDTTKYPRIGAWIKKLEQLPYYEE
ANGKGVRQLVAIFKKTNFTFEA*

RE21095.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:50:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF12171-PA 222 GF12171-PA 1..221 1..221 905 76 Plus
Dana\GF12172-PA 222 GF12172-PA 1..221 1..221 876 72.9 Plus
Dana\GF12173-PA 221 GF12173-PA 1..221 1..222 792 65.8 Plus
Dana\GF12174-PA 221 GF12174-PA 1..221 1..222 792 65.3 Plus
Dana\GF12169-PA 221 GF12169-PA 1..218 1..219 685 58 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21888-PA 240 GG21888-PA 19..239 1..221 1114 94.1 Plus
Dere\GG21887-PA 222 GG21887-PA 1..220 1..220 909 75.9 Plus
Dere\GG21890-PA 222 GG21890-PA 1..220 1..220 836 69.1 Plus
Dere\GG21889-PA 222 GG21889-PA 1..219 1..220 831 69.1 Plus
Dere\GG21886-PA 222 GG21886-PA 1..222 1..222 693 55 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:50:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH21669-PA 221 GH21669-PA 1..218 1..219 795 67.1 Plus
Dgri\GH21668-PA 217 GH21668-PA 1..213 1..214 647 57.9 Plus
Dgri\GH21671-PA 221 GH21671-PA 1..213 1..213 629 55.9 Plus
Dgri\GH15974-PA 219 GH15974-PA 1..213 1..214 593 51.9 Plus
Dgri\GH20218-PA 231 GH20218-PA 3..201 4..209 470 48.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:20
Subject Length Description Subject Range Query Range Score Percent Strand
GstE6-PA 222 CG17530-PA 1..222 1..222 1134 100 Plus
GstE5-PA 222 CG17527-PA 1..220 1..220 884 75.5 Plus
GstE8-PB 222 CG17533-PB 1..220 1..220 831 70.5 Plus
GstE8-PA 222 CG17533-PA 1..220 1..220 831 70.5 Plus
GstE7-PA 223 CG17531-PA 1..220 1..220 826 70 Plus
GstE4-PA 222 CG17525-PA 1..219 1..219 676 56.2 Plus
GstE9-PA 221 CG17534-PA 1..213 1..213 594 53.1 Plus
GstE3-PA 220 CG17524-PA 1..218 1..219 586 49.8 Plus
GstE10-PB 240 CG17522-PB 1..210 1..209 575 53.3 Plus
GstE10-PA 240 CG17522-PA 1..210 1..209 575 53.3 Plus
GstE2-PA 221 CG17523-PA 4..214 3..214 543 49.5 Plus
GstE1-PA 224 CG5164-PA 6..215 4..214 536 49.8 Plus
GstE12-PC 223 CG16936-PC 1..214 1..214 446 44.2 Plus
GstE12-PB 223 CG16936-PB 1..214 1..214 446 44.2 Plus
GstE12-PD 223 CG16936-PD 1..214 1..214 446 44.2 Plus
GstE12-PA 223 CG16936-PA 1..214 1..214 446 44.2 Plus
GstE11-PB 225 CG5224-PB 4..216 3..214 431 42.5 Plus
GstE11-PA 225 CG5224-PA 4..216 3..214 431 42.5 Plus
GstD8-PA 212 CG4421-PA 9..211 12..217 366 36.4 Plus
GstD6-PA 215 CG4423-PA 1..195 4..200 366 36.9 Plus
GstD7-PA 224 CG4371-PA 1..206 1..208 363 36.5 Plus
GstD4-PA 215 CG11512-PA 13..208 16..214 361 37.2 Plus
GstD1-PB 209 CG10045-PB 5..209 7..214 353 37.1 Plus
GstD1-PA 209 CG10045-PA 5..209 7..214 353 37.1 Plus
GstD5-PA 216 CG12242-PA 13..207 16..213 350 36.4 Plus
GstD3-PA 199 CG4381-PA 5..179 24..200 348 38.2 Plus
GstE13-PB 226 CG11784-PB 1..210 1..209 348 36 Plus
GstE13-PA 226 CG11784-PA 1..210 1..209 348 36 Plus
GstD2-PA 215 CG4181-PA 13..207 16..213 336 36.4 Plus
GstD10-PB 210 CG18548-PB 1..208 4..213 335 35.2 Plus
GstD10-PA 210 CG18548-PA 1..208 4..213 335 35.2 Plus
GstD9-PB 218 CG10091-PB 2..198 4..200 334 36.9 Plus
GstD9-PA 218 CG10091-PA 2..198 4..200 334 36.9 Plus
GstD11-PA 222 CG17639-PA 6..214 6..214 331 35.8 Plus
GstD11-PB 243 CG17639-PB 27..235 6..214 331 35.8 Plus
gfzf-PD 234 CG33546-PD 1..208 4..211 320 37.3 Plus
gfzf-PE 1045 CG33546-PE 812..1019 4..211 320 37.3 Plus
gfzf-PB 1045 CG33546-PB 812..1019 4..211 320 37.3 Plus
GstE14-PA 232 CG4688-PA 5..208 3..209 266 32.2 Plus
GstT1-PA 228 CG30000-PA 13..213 12..202 155 25.5 Plus
GstZ1-PA 246 CG9362-PA 33..229 3..199 151 29.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20123-PA 221 GI20123-PA 1..218 1..219 765 65.8 Plus
Dmoj\GI20122-PA 221 GI20122-PA 1..218 1..219 695 64.8 Plus
Dmoj\GI20121-PA 222 GI20121-PA 1..222 1..222 688 55 Plus
Dmoj\GI20124-PA 221 GI20124-PA 1..213 1..213 669 57.3 Plus
Dmoj\GI16624-PA 219 GI16624-PA 1..213 1..214 573 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:50:55
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17773-PA 222 GL17773-PA 1..220 1..220 928 77.7 Plus
Dper\GL17771-PA 221 GL17771-PA 1..218 1..219 690 56.2 Plus
Dper\GL17772-PA 222 GL17772-PA 1..220 1..219 597 49.8 Plus
Dper\GL17774-PA 221 GL17774-PA 1..213 1..213 586 53.5 Plus
Dper\GL17770-PA 222 GL17770-PA 1..220 1..219 575 48.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14545-PA 222 GA14545-PA 1..220 1..220 923 77.3 Plus
Dpse\GA14542-PA 221 GA14542-PA 1..218 1..219 689 56.2 Plus
Dpse\GA24907-PA 222 GA24907-PA 1..220 1..219 600 50.2 Plus
Dpse\GA14548-PA 221 GA14548-PA 1..213 1..213 583 53.5 Plus
Dpse\GA14541-PA 222 GA14541-PA 1..220 1..219 582 48.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:50:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21880-PA 222 GM21880-PA 1..220 1..220 916 75.5 Plus
Dsec\GM21882-PA 222 GM21882-PA 1..220 1..220 843 69.1 Plus
Dsec\GM21881-PA 223 GM21881-PA 1..220 1..220 831 69.2 Plus
Dsec\GM21879-PA 222 GM21879-PA 1..219 1..219 702 56.6 Plus
Dsec\GM21876-PA 220 GM21876-PA 1..218 1..219 591 50.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11375-PA 222 GD11375-PA 1..221 1..221 1144 98.2 Plus
Dsim\GD11374-PA 222 GD11374-PA 1..220 1..220 924 76.4 Plus
Dsim\GD11377-PA 222 GD11377-PA 1..220 1..220 843 69.1 Plus
Dsim\GD11376-PA 223 GD11376-PA 1..220 1..220 837 68.6 Plus
Dsim\GD11373-PA 222 GD11373-PA 1..219 1..219 690 55.7 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:50:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19893-PA 221 GJ19893-PA 1..218 1..219 722 67.1 Plus
Dvir\GJ19891-PA 222 GJ19891-PA 1..222 1..222 696 58.6 Plus
Dvir\GJ19892-PA 219 GJ19892-PA 1..216 1..219 670 62.1 Plus
Dvir\GJ19894-PA 221 GJ19894-PA 1..213 1..213 660 54.9 Plus
Dvir\GJ12879-PA 219 GJ12879-PA 1..213 1..214 570 50 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22991-PA 222 GK22991-PA 1..219 1..219 821 70.3 Plus
Dwil\GK22990-PA 220 GK22990-PA 1..218 1..220 762 67.7 Plus
Dwil\GK22989-PA 220 GK22989-PA 1..218 1..220 759 67.3 Plus
Dwil\GK22983-PA 222 GK22983-PA 1..222 1..222 721 58.1 Plus
Dwil\GK22984-PA 220 GK22984-PA 1..218 1..219 633 53.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:50:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11963-PA 222 GE11963-PA 1..221 1..221 1104 93.2 Plus
Dyak\GE11962-PA 222 GE11962-PA 1..222 1..222 897 73.9 Plus
Dyak\GE11964-PA 222 GE11964-PA 1..221 1..222 860 71.2 Plus
Dyak\GE11965-PA 222 GE11965-PA 1..220 1..220 849 70 Plus
Dyak\GE11961-PA 222 GE11961-PA 1..219 1..219 698 56.2 Plus