Clone RE21592 Report

Search the DGRC for RE21592

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:215
Well:92
Vector:pFlc-1
Associated Gene/TranscriptCG15515-RA
Protein status:RE21592.pep: wuzgold
Preliminary Size:327
Sequenced Size:940

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15515 2002-01-01 Sim4 clustering to Release 2
CG15515 2002-06-10 Blastp of sequenced clone
CG15515 2003-01-01 Sim4 clustering to Release 3
CG15515 2008-04-29 Release 5.5 accounting
CG15515 2008-08-15 Release 5.9 accounting
CG15515 2008-12-18 5.12 accounting

Clone Sequence Records

RE21592.complete Sequence

940 bp (940 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071168

> RE21592.complete
AGTATAGCTCGGTAACTCCATCGCGCATCAACATGGCCTCAGCGAAATTG
GTAAGCAGCTGCTCAGGGCGGAACCCTATTCCGATTCGAATTCAGCTACT
GATGCTGATTCGCATCCGGATACCTCGACCGTGTTCCAGACCTACGACTT
GGTATTGACCAGGGGGCGGCAATGTGGCCTGGCCTGGCATGTGAAGTGTG
TGCATAATCCAAATAGTGGCTGTCAATCCAATACACGATATTGATGCAGC
TGTGCTAATAGCCCGTCTTGCTGCCAAGTTACACAGTTCGCAGTTTAACT
TTTGGATTTTATTATTGGATCTATTAAATAAAACTAGTTTCAATTGTGAT
CTTATTTAAAAAGTGCAAAGTAGTGAGTGAGATATTCAATTCTTTAAAGG
TGTACAAAACATTGAATTAGCACGCTATAAGTGCATCACTTACATAGGCA
TAATTAGTTAGTCAAATATGATCCAAGACTAATGTGACCCGTTCGTTTCT
CACAGCTACTTTTCACTGCCCTGGTGGCCCTTATGGCCGCCCACAGCTCG
GCGGGACTTCTGGACTACGTCTTCCCCACCATTGTGTCGGAGTATTACAA
CCAGGCGCCGACCAAGGAGGGATACCGCTTCGCGTCGGAGGAGCCAAATG
GCAGCAAGCGCGAGGAGATGGGCGTGATCATGAACCCCGGCACTCCCGAC
GAGCAACTGGTGGTCATGGGTATGTACTCCTCGTACGATGAAAAGACTGA
CACCGAGACTGTGACGATGTACACCGCCGACAAGGATGGTTACAAGGCCC
GTTACCAGATCAAGAACCGGAAACTGAGCCCCGGAGCCCTGAAGTCCGCT
GCTGGATAAGGAGCTTGTAGATTAGAGTTGTAAATAAATGAGTCCAAAAT
ATATGCTTGCTTGCTAAGAATTTTCAAAAAAAAAAAAAAA

RE21592.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG15515-RA 1024 CG15515-RA 47..973 1..926 4595 99.8 Plus
CG15515.a 682 CG15515.a 192..613 505..926 2110 100 Plus
nc_20012.a 1221 nc_20012.a 464..784 320..1 1565 99.6 Minus
nc_20012.a 1221 nc_20012.a 1..216 849..634 1080 100 Minus
nc_20012.a 1221 nc_20012.a 272..463 635..444 960 100 Minus
CG15515.a 682 CG15515.a 143..192 1..50 250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:26:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 25727885..25728518 1..635 2880 98.3 Plus
chr3R 27901430 chr3R 25728574..25728865 634..925 1445 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:49
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 29905466..29906101 1..635 3130 99.8 Plus
3R 32079331 3R 29906157..29906449 634..926 1465 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 29646297..29646932 1..635 3140 99.8 Plus
3R 31820162 3R 29646988..29647280 634..926 1465 100 Plus
Blast to na_te.dros performed 2019-03-16 19:26:50
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle2 7220 HMS-Beagle2 Beagle2 7220bp 5550..5622 722..794 113 65.3 Plus

RE21592.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:27:53 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 25727885..25728516 1..633 98 -> Plus
chr3R 25728574..25728865 634..925 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:46 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..327 533..859 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:55 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..327 533..859 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed on 2013-08-04 17:40:28 has no hits.
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:27 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..327 533..859 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 15:32:01 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:32 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..926 1..925 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:54 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..926 1..925 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-04 17:40:28 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:27 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
CG15515-RA 1..926 1..925 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 15:32:01 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29905466..29906099 1..633 99 -> Plus
3R 29906157..29906448 634..925 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29905466..29906099 1..633 99 -> Plus
3R 29906157..29906448 634..925 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29905466..29906099 1..633 99 -> Plus
3R 29906157..29906448 634..925 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:28 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 25731188..25731821 1..633 99 -> Plus
arm_3R 25731879..25732170 634..925 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:35 Download gff for RE21592.complete
Subject Subject Range Query Range Percent Splice Strand
3R 29646297..29646930 1..633 99 -> Plus
3R 29646988..29647279 634..925 100   Plus

RE21592.pep Sequence

Translation from 532 to 858

> RE21592.pep
MAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIM
NPGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSP
GALKSAAG*

RE21592.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18804-PA 123 GF18804-PA 16..123 1..108 542 92.6 Plus
Dana\GF15541-PA 124 GF15541-PA 18..124 2..108 424 72 Plus
Dana\GF18805-PA 104 GF18805-PA 1..104 1..108 332 60.2 Plus
Dana\GF14358-PA 118 GF14358-PA 21..118 5..108 253 48.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11706-PA 123 GG11706-PA 16..123 1..108 491 92.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH16751-PA 91 GH16751-PA 1..91 18..108 414 84.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG15515-PB 123 CG15515-PB 16..123 1..108 561 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22307-PA 123 GI22307-PA 16..123 1..108 477 79.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL14004-PA 123 GL14004-PA 16..123 1..108 489 84.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13776-PA 123 GA13776-PA 16..123 1..108 489 84.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12837-PA 123 GM12837-PA 16..123 1..108 546 95.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21480-PA 123 GD21480-PA 16..123 1..108 570 99.1 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10494-PA 123 GJ10494-PA 16..123 1..108 491 82.4 Plus
Dvir\GJ10493-PA 108 GJ10493-PA 1..108 1..108 463 79.6 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13190-PA 108 GK13190-PA 1..108 1..108 442 75.9 Plus
Dwil\GK13191-PA 123 GK13191-PA 16..123 1..108 433 73.1 Plus
Dwil\GK13192-PA 110 GK13192-PA 1..106 1..106 391 67.9 Plus
Dwil\GK17271-PA 102 GK17271-PA 32..91 29..88 131 45 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE23898-PA 124 GE23898-PA 24..124 8..108 522 95 Plus

RE21592.hyp Sequence

Translation from 532 to 858

> RE21592.hyp
MAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIM
NPGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSP
GALKSAAG*

RE21592.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG15515-PB 123 CG15515-PB 16..123 1..108 561 100 Plus