RE21592.complete Sequence
940 bp (940 high quality bases) assembled on 2002-06-10
GenBank Submission: AY071168
> RE21592.complete
AGTATAGCTCGGTAACTCCATCGCGCATCAACATGGCCTCAGCGAAATTG
GTAAGCAGCTGCTCAGGGCGGAACCCTATTCCGATTCGAATTCAGCTACT
GATGCTGATTCGCATCCGGATACCTCGACCGTGTTCCAGACCTACGACTT
GGTATTGACCAGGGGGCGGCAATGTGGCCTGGCCTGGCATGTGAAGTGTG
TGCATAATCCAAATAGTGGCTGTCAATCCAATACACGATATTGATGCAGC
TGTGCTAATAGCCCGTCTTGCTGCCAAGTTACACAGTTCGCAGTTTAACT
TTTGGATTTTATTATTGGATCTATTAAATAAAACTAGTTTCAATTGTGAT
CTTATTTAAAAAGTGCAAAGTAGTGAGTGAGATATTCAATTCTTTAAAGG
TGTACAAAACATTGAATTAGCACGCTATAAGTGCATCACTTACATAGGCA
TAATTAGTTAGTCAAATATGATCCAAGACTAATGTGACCCGTTCGTTTCT
CACAGCTACTTTTCACTGCCCTGGTGGCCCTTATGGCCGCCCACAGCTCG
GCGGGACTTCTGGACTACGTCTTCCCCACCATTGTGTCGGAGTATTACAA
CCAGGCGCCGACCAAGGAGGGATACCGCTTCGCGTCGGAGGAGCCAAATG
GCAGCAAGCGCGAGGAGATGGGCGTGATCATGAACCCCGGCACTCCCGAC
GAGCAACTGGTGGTCATGGGTATGTACTCCTCGTACGATGAAAAGACTGA
CACCGAGACTGTGACGATGTACACCGCCGACAAGGATGGTTACAAGGCCC
GTTACCAGATCAAGAACCGGAAACTGAGCCCCGGAGCCCTGAAGTCCGCT
GCTGGATAAGGAGCTTGTAGATTAGAGTTGTAAATAAATGAGTCCAAAAT
ATATGCTTGCTTGCTAAGAATTTTCAAAAAAAAAAAAAAA
RE21592.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 18:49:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15515-RA | 1024 | CG15515-RA | 47..973 | 1..926 | 4595 | 99.8 | Plus |
CG15515.a | 682 | CG15515.a | 192..613 | 505..926 | 2110 | 100 | Plus |
nc_20012.a | 1221 | nc_20012.a | 464..784 | 320..1 | 1565 | 99.6 | Minus |
nc_20012.a | 1221 | nc_20012.a | 1..216 | 849..634 | 1080 | 100 | Minus |
nc_20012.a | 1221 | nc_20012.a | 272..463 | 635..444 | 960 | 100 | Minus |
CG15515.a | 682 | CG15515.a | 143..192 | 1..50 | 250 | 100 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:26:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr3R | 27901430 | chr3R | 25727885..25728518 | 1..635 | 2880 | 98.3 | Plus |
chr3R | 27901430 | chr3R | 25728574..25728865 | 634..925 | 1445 | 99.7 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:26:49
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 29905466..29906101 | 1..635 | 3130 | 99.8 | Plus |
3R | 32079331 | 3R | 29906157..29906449 | 634..926 | 1465 | 100 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 31820162 | 3R | 29646297..29646932 | 1..635 | 3140 | 99.8 | Plus |
3R | 31820162 | 3R | 29646988..29647280 | 634..926 | 1465 | 100 | Plus |
Blast to na_te.dros performed 2019-03-16 19:26:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle2 | 7220 | HMS-Beagle2 Beagle2 7220bp | 5550..5622 | 722..794 | 113 | 65.3 | Plus |
RE21592.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:27:53 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr3R | 25727885..25728516 | 1..633 | 98 | -> | Plus |
chr3R | 25728574..25728865 | 634..925 | 99 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:46 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..327 | 533..859 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:55 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..327 | 533..859 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed on 2013-08-04 17:40:28 has no hits.
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:27 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..327 | 533..859 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed on 2014-11-27 15:32:01 has no hits.
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:32 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..926 | 1..925 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:54 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..926 | 1..925 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed on 2013-08-04 17:40:28 has no hits.
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:27 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15515-RA | 1..926 | 1..925 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed on 2014-11-27 15:32:01 has no hits.
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29905466..29906099 | 1..633 | 99 | -> | Plus |
3R | 29906157..29906448 | 634..925 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29905466..29906099 | 1..633 | 99 | -> | Plus |
3R | 29906157..29906448 | 634..925 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:53 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29905466..29906099 | 1..633 | 99 | -> | Plus |
3R | 29906157..29906448 | 634..925 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:28 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 25731188..25731821 | 1..633 | 99 | -> | Plus |
arm_3R | 25731879..25732170 | 634..925 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:35 Download gff for
RE21592.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 29646297..29646930 | 1..633 | 99 | -> | Plus |
3R | 29646988..29647279 | 634..925 | 100 | | Plus |
RE21592.pep Sequence
Translation from 532 to 858
> RE21592.pep
MAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIM
NPGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSP
GALKSAAG*
RE21592.pep Blast Records
Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 05:49:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dana\GF18804-PA | 123 | GF18804-PA | 16..123 | 1..108 | 542 | 92.6 | Plus |
Dana\GF15541-PA | 124 | GF15541-PA | 18..124 | 2..108 | 424 | 72 | Plus |
Dana\GF18805-PA | 104 | GF18805-PA | 1..104 | 1..108 | 332 | 60.2 | Plus |
Dana\GF14358-PA | 118 | GF14358-PA | 21..118 | 5..108 | 253 | 48.1 | Plus |
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 05:49:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG11706-PA | 123 | GG11706-PA | 16..123 | 1..108 | 491 | 92.6 | Plus |
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 05:49:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dgri\GH16751-PA | 91 | GH16751-PA | 1..91 | 18..108 | 414 | 84.6 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:26
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15515-PB | 123 | CG15515-PB | 16..123 | 1..108 | 561 | 100 | Plus |
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 05:49:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dmoj\GI22307-PA | 123 | GI22307-PA | 16..123 | 1..108 | 477 | 79.6 | Plus |
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 05:49:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dper\GL14004-PA | 123 | GL14004-PA | 16..123 | 1..108 | 489 | 84.3 | Plus |
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 05:49:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dpse\GA13776-PA | 123 | GA13776-PA | 16..123 | 1..108 | 489 | 84.3 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 05:49:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM12837-PA | 123 | GM12837-PA | 16..123 | 1..108 | 546 | 95.4 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 05:49:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD21480-PA | 123 | GD21480-PA | 16..123 | 1..108 | 570 | 99.1 | Plus |
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 05:49:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dvir\GJ10494-PA | 123 | GJ10494-PA | 16..123 | 1..108 | 491 | 82.4 | Plus |
Dvir\GJ10493-PA | 108 | GJ10493-PA | 1..108 | 1..108 | 463 | 79.6 | Plus |
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 05:49:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dwil\GK13190-PA | 108 | GK13190-PA | 1..108 | 1..108 | 442 | 75.9 | Plus |
Dwil\GK13191-PA | 123 | GK13191-PA | 16..123 | 1..108 | 433 | 73.1 | Plus |
Dwil\GK13192-PA | 110 | GK13192-PA | 1..106 | 1..106 | 391 | 67.9 | Plus |
Dwil\GK17271-PA | 102 | GK17271-PA | 32..91 | 29..88 | 131 | 45 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 05:49:22
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE23898-PA | 124 | GE23898-PA | 24..124 | 8..108 | 522 | 95 | Plus |
RE21592.hyp Sequence
Translation from 532 to 858
> RE21592.hyp
MAAHSSAGLLDYVFPTIVSEYYNQAPTKEGYRFASEEPNGSKREEMGVIM
NPGTPDEQLVVMGMYSSYDEKTDTETVTMYTADKDGYKARYQIKNRKLSP
GALKSAAG*
RE21592.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:43:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15515-PB | 123 | CG15515-PB | 16..123 | 1..108 | 561 | 100 | Plus |