Clone RE21703 Report

Search the DGRC for RE21703

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:217
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG40198-RB
Protein status:RE21703.pep: gold
Sequenced Size:682

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG15848 2002-01-01 Sim4 clustering to Release 2
CG40198 2002-04-04 Blastp of sequenced clone
CG40198 2003-01-01 Sim4 clustering to Release 3
CG40198 2008-04-29 Release 5.5 accounting
CG40198 2008-08-15 Release 5.9 accounting
CG40198 2008-12-18 5.12 accounting

Clone Sequence Records

RE21703.complete Sequence

682 bp (682 high quality bases) assembled on 2002-04-04

GenBank Submission: AY095073

> RE21703.complete
TTGTCATAAAGTAGTCGCCAACAGCATGTTGAAAACTATATCGATTGGTG
TTCTTATCGCCCTCAGTGGGGCCATCATTGCAGAAGGAAAACCTGTCCTT
ATTAAGGTTTTCGCTCCCAGCGGTGGCTACTCCAGTGCCAGTTACCAAAA
TACAGTGGGAGCATCGCCTTTCACCAGTCAGCTTATCTCTGGTCTTATCT
CATCAAAAATTCAACTGTTGAACAGCGTGCTACAGACCAAGTCTTCTTCC
GGGGGGTTCCGTATTGGTTTCAATAAGTCTGTCAATTTATTTGGCCCCAC
AAGCGCCACGAGCACCACCGAAAGGCCTGTGACACACCATACCACCGAGG
TAAACACAGACTTTACTCCGGATGAATCTAGTAGGACTACTCAACTTTTT
TACTCGACAACAACAGAAAGTTTTGTCGAAACGCCGATCCCCACAATACA
TCCCGAGCCACCAGCCACTACCACTTCAGTGATCCCAATAGAGAGCACCA
CATCCGTAACACAACCACCCATCTTGACGACACCAAAACCTGGATACTCC
TATCGCACCCCCATTTCCCCCACCAATTAGTTCGGTGAAAATCTATTTTT
TGTCAACTCAAATAACGCAGCCCCAGCAATGTTCGCAAATGAGTAAATTT
CTATAATTAAGTGACTAAAAAAAAAAAAAAAA

RE21703.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG40198.c 1325 CG40198.c 167..832 3..668 3330 100 Plus
CG40198.e 1728 CG40198.e 167..832 3..668 3330 100 Plus
CG40198.g 1481 CG40198.g 167..832 3..668 3330 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:38:53
Subject Length Description Subject Range Query Range Score Percent Strand
chr3RHet 2517486 chr3RHet 2505253..2505794 666..125 2710 100 Minus
chr3RHet 2517486 chr3RHet 2505852..2505975 126..3 620 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4161506..4162049 668..125 2720 100 Minus
3R 32079331 3R 4162107..4162230 126..3 620 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:15:39
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 3822944..3823487 668..125 2720 100 Minus
3R 31820162 3R 3823545..3823668 126..3 620 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:38:52 has no hits.

RE21703.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:40:03 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
chr3RHet 2505253..2505793 126..666 100 <- Minus
chr3RHet 2505853..2505977 1..125 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:01:53 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RA 249..828 1..580 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:15:27 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RB 1..555 26..580 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:24 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RC 1..555 26..580 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:06:23 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RA 249..828 1..580 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:21:48 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RC 1..555 26..580 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:39:04 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RA 249..914 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:15:27 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RB 1..666 2..666 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:24 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RC 4..669 1..666 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:06:23 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RA 249..914 1..666 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:21:48 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
CG40198-RC 4..669 1..666 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:03 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4161508..4162048 126..666 100 <- Minus
3R 4162108..4162232 1..125 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:03 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4161508..4162048 126..666 100 <- Minus
3R 4162108..4162232 1..125 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:03 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4161508..4162048 126..666 100 <- Minus
3R 4162108..4162232 1..125 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:24 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
3RHet 2505274..2505814 126..666 100 <- Minus
3RHet 2505874..2505998 1..125 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:38:21 Download gff for RE21703.complete
Subject Subject Range Query Range Percent Splice Strand
3R 3822946..3823486 126..666 100 <- Minus
3R 3823546..3823670 1..125 99   Minus

RE21703.hyp Sequence

Translation from 0 to 579

> RE21703.hyp
SHKVVANSMLKTISIGVLIALSGAIIAEGKPVLIKVFAPSGGYSSASYQN
TVGASPFTSQLISGLISSKIQLLNSVLQTKSSSGGFRIGFNKSVNLFGPT
SATSTTERPVTHHTTEVNTDFTPDESSRTTQLFYSTTTESFVETPIPTIH
PEPPATTTSVIPIESTTSVTQPPILTTPKPGYSYRTPISPTN*

RE21703.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG40198-PB 184 CG40198-PB 1..184 9..192 929 100 Plus
CG40198-PC 184 CG40198-PC 1..184 9..192 929 100 Plus

RE21703.pep Sequence

Translation from 25 to 579

> RE21703.pep
MLKTISIGVLIALSGAIIAEGKPVLIKVFAPSGGYSSASYQNTVGASPFT
SQLISGLISSKIQLLNSVLQTKSSSGGFRIGFNKSVNLFGPTSATSTTER
PVTHHTTEVNTDFTPDESSRTTQLFYSTTTESFVETPIPTIHPEPPATTT
SVIPIESTTSVTQPPILTTPKPGYSYRTPISPTN*

RE21703.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 04:07:35
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23136-PA 201 GF23136-PA 1..181 1..179 301 50.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 04:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG11818-PA 184 GG11818-PA 1..177 1..179 614 80.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 04:07:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20635-PA 244 GH20635-PA 1..197 1..184 351 48.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:23:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG40198-PB 184 CG40198-PB 1..184 1..184 929 100 Plus
CG40198-PC 184 CG40198-PC 1..184 1..184 929 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 04:07:37
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23203-PA 213 GI23203-PA 1..155 1..159 316 54.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 04:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12342-PA 185 GL12342-PA 1..166 18..179 297 59.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 04:07:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27473-PA 185 GA27473-PA 1..166 18..179 289 59.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 04:07:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10728-PA 184 GM10728-PA 1..179 1..179 757 90.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 04:07:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22865-PA 205 GJ22865-PA 1..179 1..184 358 51.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 04:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14346-PA 207 GK14346-PA 1..156 1..151 295 58.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 04:07:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE25376-PA 168 GE25376-PA 1..162 18..179 658 83.3 Plus