Clone RE21944 Report

Search the DGRC for RE21944

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:219
Well:44
Vector:pFlc-1
Associated Gene/TranscriptCG14568-RA
Protein status:RE21944.pep: gold
Preliminary Size:453
Sequenced Size:695

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14568 2001-12-14 Blastp of sequenced clone
CG14568 2002-01-01 Sim4 clustering to Release 2
CG14568 2003-01-01 Sim4 clustering to Release 3
CG14568 2008-04-29 Release 5.5 accounting
CG14568 2008-08-15 Release 5.9 accounting
CG14568 2008-12-18 5.12 accounting

Clone Sequence Records

RE21944.complete Sequence

695 bp (695 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071171

> RE21944.complete
AACATTCTAAGACAACTCAGCAGCAGCTCAACATGGCCCACAAGTTCATC
TGCTCCCTGCTCCTGATCGCAGCCATGGCTGCCGTTTCTGTTGCAGAGCC
TACCAGATTCCGGGGACGATTTTCCCGCCTGCAGTTTGCCCGTCAGGAGC
AGGCTCCAGGGGATCAGGCAGTTCCGGCCGACCCCGCCGTGGATATTGCA
CCTACGCCGGCCTCAGCCCCTTATCCGCCAGCAGGAGTGACACCGGAGGT
GCCCTTCGACCTGCCCACGGAGACTGAAGCGCAACCTGATCTTACCTACG
GACCCCCAGATGAGCCCGACAACACCTACGGCCCTCCCGATAACACTTAC
GGACCACCTGCTGAGCCGGAAAACACCTATGGACCGCCGGCTGATGGCCC
AGTGGACCAGGCCCCTGCTGCCGATCCCGTGCCCGCCGGCTTGATCCAGC
CTCGTAACGAACGCCTCCTCAGTCGTCGTCCGACCCCAGAGAAGCTTCGA
TCCGCTCAGATTATCCGCTCTGGATCAGTTCTGGTGTACACCATCTGAAA
TGGGTCAACCCTAATTTGCTAGAAATCAAATGGAATCGACTCATTAGGAT
ATGCATTTATTACTTTGTCGCTAAATAAATTGTTGTTGAATATTTTAATT
TAAATAATAAAATAATTGCGTTAATATCCAAAAAAAAAAAAAAAA

RE21944.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG14568-RA 679 CG14568-RA 1..677 1..677 3385 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:27:58
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 21721743..21722419 677..1 3385 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:41:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:27:56
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 21732804..21733484 681..1 3390 99.9 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:34
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 21725904..21726584 681..1 3390 99.8 Minus
Blast to na_te.dros performed on 2019-03-16 01:27:56 has no hits.

RE21944.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:29:12 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 21721786..21722419 1..634 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:11 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..516 33..548 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:11:44 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..516 33..548 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:06:46 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..516 33..548 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:58 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..516 33..548 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:34:14 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..516 33..548 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:42:08 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..676 1..676 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:11:44 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..679 1..679 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:06:46 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 4..682 1..679 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:59 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 1..676 1..676 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:34:14 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
CG14568-RA 4..682 1..679 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:12 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21732806..21733484 1..679 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:12 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21732806..21733484 1..679 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:12 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21732806..21733484 1..679 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:06:46 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 21725906..21726584 1..679 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:13:19 Download gff for RE21944.complete
Subject Subject Range Query Range Percent Splice Strand
3L 21725906..21726584 1..679 99   Minus

RE21944.hyp Sequence

Translation from 2 to 547

> RE21944.hyp
HSKTTQQQLNMAHKFICSLLLIAAMAAVSVAEPTRFRGRFSRLQFARQEQ
APGDQAVPADPAVDIAPTPASAPYPPAGVTPEVPFDLPTETEAQPDLTYG
PPDEPDNTYGPPDNTYGPPAEPENTYGPPADGPVDQAPAADPVPAGLIQP
RNERLLSRRPTPEKLRSAQIIRSGSVLVYTI*

RE21944.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG14568-PA 171 CG14568-PA 1..171 11..181 905 100 Plus
CG14569-PA 195 CG14569-PA 11..114 20..149 217 42.5 Plus
CG14570-PA 228 CG14570-PA 14..166 16..169 199 33.7 Plus
CG14566-PB 166 CG14566-PB 6..121 19..136 163 40.6 Plus
CG14566-PA 166 CG14566-PA 6..121 19..136 163 40.6 Plus

RE21944.pep Sequence

Translation from 32 to 547

> RE21944.pep
MAHKFICSLLLIAAMAAVSVAEPTRFRGRFSRLQFARQEQAPGDQAVPAD
PAVDIAPTPASAPYPPAGVTPEVPFDLPTETEAQPDLTYGPPDEPDNTYG
PPDNTYGPPAEPENTYGPPADGPVDQAPAADPVPAGLIQPRNERLLSRRP
TPEKLRSAQIIRSGSVLVYTI*

RE21944.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:16:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24639-PA 179 GF24639-PA 1..179 1..171 696 82.7 Plus
Dana\GF24641-PA 239 GF24641-PA 49..128 62..114 138 45 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13205-PA 171 GG13205-PA 1..171 1..171 710 89.5 Plus
Dere\GG13206-PA 195 GG13206-PA 34..114 53..139 182 56.8 Plus
Dere\GG13207-PA 228 GG13207-PA 44..157 61..150 144 40.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:16:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15094-PA 180 GH15094-PA 39..180 38..171 371 69.4 Plus
Dgri\GH15095-PA 174 GH15095-PA 5..115 7..131 138 40 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG14568-PA 171 CG14568-PA 1..171 1..171 905 100 Plus
CG14569-PA 195 CG14569-PA 11..114 10..139 217 42.5 Plus
CG14570-PA 228 CG14570-PA 14..166 6..159 199 33.7 Plus
CG14566-PB 166 CG14566-PB 6..121 9..126 163 40.6 Plus
CG14566-PA 166 CG14566-PA 6..121 9..126 163 40.6 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13743-PA 209 GI13743-PA 25..208 1..171 392 65.3 Plus
Dmoj\GI13744-PA 188 GI13744-PA 5..88 7..109 191 50 Plus
Dmoj\GI13745-PA 265 GI13745-PA 37..120 61..119 177 53.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:16:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25274-PA 184 GL25274-PA 1..184 1..171 460 59.1 Plus
Dper\GL25275-PA 196 GL25275-PA 8..96 7..110 206 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:16:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13087-PA 181 GA13087-PA 1..181 1..171 598 73.5 Plus
Dpse\GA13088-PA 196 GA13088-PA 8..96 7..110 210 50.9 Plus
Dpse\GA13089-PA 225 GA13089-PA 2..129 1..139 167 37.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22114-PA 171 GM22114-PA 1..171 1..171 808 95.3 Plus
Dsec\GM22115-PA 195 GM22115-PA 11..114 10..139 179 42.5 Plus
Dsec\GM22116-PA 228 GM22116-PA 9..132 1..139 161 35.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:16:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12091-PA 171 GD12091-PA 1..171 1..171 818 96.5 Plus
Dsim\GD12092-PA 195 GD12092-PA 11..114 10..139 194 45.8 Plus
Dsim\GD12093-PA 228 GD12093-PA 9..117 1..114 160 36.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ14088-PA 177 GJ14088-PA 1..177 1..171 452 60.4 Plus
Dvir\GJ14090-PA 189 GJ14090-PA 5..105 7..132 189 43.3 Plus
Dvir\GJ14091-PA 261 GJ14091-PA 37..109 61..128 177 57.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:16:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17124-PA 178 GK17124-PA 21..178 20..171 361 65.5 Plus
Dwil\GK17127-PA 230 GK17127-PA 33..106 62..121 180 59.5 Plus
Dwil\GK17126-PA 185 GK17126-PA 1..95 1..114 150 44.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:16:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE22985-PA 171 GE22985-PA 1..171 1..171 778 89.5 Plus
Dyak\GE22299-PA 171 GE22299-PA 1..171 1..171 778 89.5 Plus
Dyak\GE22986-PA 195 GE22986-PA 34..114 53..139 172 54.5 Plus
Dyak\GE22300-PA 195 GE22300-PA 34..114 53..139 172 54.5 Plus
Dyak\GE22987-PA 220 GE22987-PA 9..125 1..134 171 37.4 Plus