Clone RE22146 Report

Search the DGRC for RE22146

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:221
Well:46
Vector:pFlc-1
Associated Gene/TranscriptCG10903-RA
Protein status:RE22146.pep: gold
Preliminary Size:831
Sequenced Size:1138

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10903 2001-12-14 Blastp of sequenced clone
CG10903 2002-01-01 Sim4 clustering to Release 2
CG10903 2003-01-01 Sim4 clustering to Release 3
CG10903 2008-04-29 Release 5.5 accounting
CG10903 2008-08-15 Release 5.9 accounting
CG10903 2008-12-18 5.12 accounting

Clone Sequence Records

RE22146.complete Sequence

1138 bp (1138 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071172

> RE22146.complete
GTGAATGAGAAACAGCTGCTTGTTGATTGCACATGTGCTTATTTTTTTGT
TTACCTAAACGCTCCAGAATTTCTGTGCACAACTTTGTAAATTACAGATA
AATAATATAGGAAGAATGGCCAGAAGACCAGAGCATTCGGCGCCGCCAGA
AATTTTCTACAACGATGATGAGGCCAAGAAATATTCCACAAACACCCGCA
TCATTGAGATCCAAGTAGAAATGGCCGAACGTGCCTTGGAACTATTGGCG
CTCCCGGATGATGATGAGTCTCGGTTGATTTTGGACATCGGCTGTGGTTC
TGGACTCTCAGGTAGCGTTCTTGAGGACAGCGAGCACATGTGGATCGGCA
TAGATATTTCCAAGTCTATGCTCGATATCGCCGTGGAACGCGAGGTTGCT
GGGGATGTCATTCTGGGAGACATGGGCGAGGGAATGCCCTTTAAGCCGGG
CACTTTCGACGGCGCCATCTCGATCTCTGCCCTCCAATGGCTCTGCAATG
CGGACAAGTCGTATCACAATCCCCACAAGCGCCTGCTGAAGTTCTTTACC
ACCTTGTTTTCCTGTCTGACACGCACCGCGCGAGCTGTCTTTCAATTTTA
TCCGGAGAACTCCGATCAGATCGAGATGGTAACCTCGCAAGCCATGAAGG
CGGGATTCTACGGAGGATTGGTTGTCGACTATCCAAACTCTGCCAAGGCT
AAGAAGTACTACCTGGTGCTCATGACTGGAGGATCTGCTGAGCTGCCGCA
GGCTTTGGGCTCACCTGAAGAGGAACGTCGTGTAAACTATATAAAGAAAC
GTGATGCTTGCCGTGAGGCTCGGGGAAAAGCGCCAAAGAAATCCCGCGAT
TGGATCCTAGCCAAGAAAGAGCGTCGACGTCGCCAGGGGTTGGAAACCCG
TCCTGACACAAAGTACACTGCACGCAAGCGCAGCGGCAAATTTTGAATAA
AGTTGTTACATTTAAAATTAGTGACAGACCTAATCTCTAATTGCGGCTTT
GTCTATATGTTTTAGATCTTGAGTCAGATTAAGGATATTACAATGCCGTT
GGATGTTTATATACATATGTATAAGTCCCGCTGCTATTCATCTTAAGTAA
AACGGACACATCTTTAATTCACAAAAAAAAAAAAAAAA

RE22146.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG10903-RA 1122 CG10903-RA 1..1122 1..1122 5610 100 Plus
CG10903.b 999 CG10903.b 32..999 155..1122 4840 100 Plus
CG10903.a 1009 CG10903.a 80..1009 193..1122 4650 100 Plus
CG10903.a 1009 CG10903.a 32..69 155..192 190 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:48:15
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 3857218..3857784 193..759 2835 100 Plus
chr3R 27901430 chr3R 3857853..3858218 758..1122 1765 99.5 Plus
chr3R 27901430 chr3R 3856901..3857054 1..154 770 100 Plus
chr3L 24539361 chr3L 5920400..5920444 994..1038 195 95.6 Plus
chr3R 27901430 chr3R 3857118..3857155 155..192 190 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:05 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 8031146..8031712 193..759 2835 100 Plus
3R 32079331 3R 8031781..8032149 758..1126 1845 100 Plus
3R 32079331 3R 8030829..8030982 1..154 770 100 Plus
3L 28110227 3L 5927804..5927848 994..1038 195 95.6 Plus
3R 32079331 3R 8031046..8031083 155..192 190 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:59
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 7771977..7772543 193..759 2835 100 Plus
3R 31820162 3R 7772612..7772980 758..1126 1845 100 Plus
3R 31820162 3R 7771660..7771813 1..154 770 100 Plus
3L 28103327 3L 5920904..5920948 994..1038 195 95.5 Plus
3R 31820162 3R 7771877..7771914 155..192 190 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:48:14 has no hits.

RE22146.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:49:25 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 3856901..3857054 1..154 100 -> Plus
chr3R 3857118..3857155 155..192 100 -> Plus
chr3R 3857218..3857783 193..758 100 -> Plus
chr3R 3857854..3858218 759..1122 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:15 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..831 116..946 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:07:28 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..831 116..946 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:27:52 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..831 116..946 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:49 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..831 116..946 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:55:58 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..831 116..946 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:04 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:07:27 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:27:52 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 3..1124 1..1122 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:49 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 1..1122 1..1122 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:55:58 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
CG10903-RA 3..1124 1..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:25 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8030829..8030982 1..154 100 -> Plus
3R 8031046..8031083 155..192 100 -> Plus
3R 8031146..8031711 193..758 100 -> Plus
3R 8031782..8032145 759..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:25 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8030829..8030982 1..154 100 -> Plus
3R 8031046..8031083 155..192 100 -> Plus
3R 8031146..8031711 193..758 100 -> Plus
3R 8031782..8032145 759..1122 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:25 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8030829..8030982 1..154 100 -> Plus
3R 8031046..8031083 155..192 100 -> Plus
3R 8031146..8031711 193..758 100 -> Plus
3R 8031782..8032145 759..1122 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:27:52 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 3856551..3856704 1..154 100 -> Plus
arm_3R 3856768..3856805 155..192 100 -> Plus
arm_3R 3856868..3857433 193..758 100 -> Plus
arm_3R 3857504..3857867 759..1122 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:08:32 Download gff for RE22146.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7771977..7772542 193..758 100 -> Plus
3R 7772613..7772976 759..1122 100   Plus
3R 7771660..7771813 1..154 100 -> Plus
3R 7771877..7771914 155..192 100 -> Plus

RE22146.hyp Sequence

Translation from 115 to 945

> RE22146.hyp
MARRPEHSAPPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDD
ESRLILDIGCGSGLSGSVLEDSEHMWIGIDISKSMLDIAVEREVAGDVIL
GDMGEGMPFKPGTFDGAISISALQWLCNADKSYHNPHKRLLKFFTTLFSC
LTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAKKYYL
VLMTGGSAELPQALGSPEEERRVNYIKKRDACREARGKAPKKSRDWILAK
KERRRRQGLETRPDTKYTARKRSGKF*

RE22146.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10903-PB 276 CG10903-PB 1..276 1..276 1433 100 Plus
CG10903-PA 276 CG10903-PA 1..276 1..276 1433 100 Plus

RE22146.pep Sequence

Translation from 115 to 945

> RE22146.pep
MARRPEHSAPPEIFYNDDEAKKYSTNTRIIEIQVEMAERALELLALPDDD
ESRLILDIGCGSGLSGSVLEDSEHMWIGIDISKSMLDIAVEREVAGDVIL
GDMGEGMPFKPGTFDGAISISALQWLCNADKSYHNPHKRLLKFFTTLFSC
LTRTARAVFQFYPENSDQIEMVTSQAMKAGFYGGLVVDYPNSAKAKKYYL
VLMTGGSAELPQALGSPEEERRVNYIKKRDACREARGKAPKKSRDWILAK
KERRRRQGLETRPDTKYTARKRSGKF*

RE22146.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:56:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18155-PA 276 GF18155-PA 1..276 1..276 1464 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:56:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14363-PA 276 GG14363-PA 1..276 1..276 1468 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH17335-PA 276 GH17335-PA 1..276 1..276 1435 95.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:05:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG10903-PB 276 CG10903-PB 1..276 1..276 1433 100 Plus
CG10903-PA 276 CG10903-PA 1..276 1..276 1433 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:56:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10260-PA 276 GI10260-PA 1..276 1..276 1426 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21481-PA 277 GL21481-PA 1..277 1..276 1425 95.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:56:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10628-PA 277 GA10628-PA 1..277 1..276 1432 96.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10995-PA 276 GM10995-PA 1..276 1..276 1466 99.3 Plus
Dsec\GM19349-PA 166 GM19349-PA 1..164 1..164 822 92.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:56:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19965-PA 276 GD19965-PA 1..276 1..276 1466 99.3 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:56:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11066-PA 276 GJ11066-PA 1..276 1..276 1445 96.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13473-PA 276 GK13473-PA 1..276 1..276 1410 93.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:56:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24963-PA 276 GE24963-PA 1..276 1..276 1459 98.6 Plus