BDGP Sequence Production Resources |
Search the DGRC for RE22207
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 222 |
Well: | 7 |
Vector: | pFlc-1 |
Associated Gene/Transcript | Obp56d-RA |
Protein status: | RE22207.pep: gold |
Sequenced Size: | 585 |
Gene | Date | Evidence |
---|---|---|
CG11218 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11218 | 2002-04-21 | Blastp of sequenced clone |
CG11218 | 2003-01-01 | Sim4 clustering to Release 3 |
Obp56d | 2008-04-29 | Release 5.5 accounting |
Obp56d | 2008-08-15 | Release 5.9 accounting |
Obp56d | 2008-12-18 | 5.12 accounting |
585 bp (585 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113425
> RE22207.complete AGCGGTTTCGATACCAAAGGGTTTCCAACAACATCTCTACCGAAAATGAA GTTCCTGATTGTCCTCTCCGTCATTTTGGCCATTTCGGCTGCTGAGCTGC AACTATCCGATGAGCAGAAGGCTGTGGCCCATGCCAATGGCGCCCTTTGT GCCCAGCAGGAGGGAATCACCAAGGATCAGGCGATCGCCTTGCGAAACGG CAATTTCGATGACAGTGACCCCAAGGTGAAATGCTTCGCCAATTGTTTCT TGGAGAAAATCGGATTCCTGATCAATGGTGAGGTCCAGCCCGATGTCGTT CTGGCCAAGTTGGGACCCCTGGCCGGCGAGGATGCCGTGAAGGCCGTTCA GGCCAAGTGTGATGCCACCAAGGGAGCGGATAAGTGCGATACTGCCTATC AGCTATTCGAGTGCTACTACAAGAATCGCGCCCACATCTAAGCGCCAAAT CTCCGATATTCTCCTGTGTGATAATCTGTCTGTGACTTGTTACTTATATT GTTTTAATTCAGTATATCAATTCGTAAACAAAATTTTTAGATCTGTAAAT GTTTTGAATAATAAACTCAAGAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 15590363..15590840 | 571..94 | 2375 | 99.8 | Minus |
chr2R | 21145070 | chr2R | 15590910..15590999 | 94..5 | 450 | 100 | Minus |
chr2R | 21145070 | chr2R | 15599773..15600058 | 157..442 | 275 | 73.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 19703153..19703632 | 573..94 | 2400 | 100 | Minus |
2R | 25286936 | 2R | 19703702..19703791 | 94..5 | 450 | 100 | Minus |
2R | 25286936 | 2R | 19712567..19712852 | 157..442 | 260 | 72.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 19704352..19704831 | 573..94 | 2400 | 100 | Minus |
2R | 25260384 | 2R | 19704901..19704990 | 94..5 | 450 | 100 | Minus |
2R | 25260384 | 2R | 19713958..19714051 | 349..442 | 200 | 80.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 15590363..15590840 | 94..571 | 99 | <- | Minus |
chr2R | 15590911..15591002 | 1..93 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..396 | 46..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..396 | 46..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..396 | 46..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..396 | 46..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..396 | 46..441 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..571 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..571 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 5..575 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 1..571 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
Obp56d-RA | 5..575 | 1..571 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19703155..19703632 | 94..571 | 100 | <- | Minus |
2R | 19703703..19703794 | 1..93 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19703155..19703632 | 94..571 | 100 | <- | Minus |
2R | 19703703..19703794 | 1..93 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19703155..19703632 | 94..571 | 100 | <- | Minus |
2R | 19703703..19703794 | 1..93 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 15590660..15591137 | 94..571 | 100 | <- | Minus |
arm_2R | 15591208..15591299 | 1..93 | 97 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 19704354..19704831 | 94..571 | 100 | <- | Minus |
2R | 19704902..19704993 | 1..93 | 97 | Minus |
Translation from 3 to 440
> RE22207.hyp SFDTKGFPTTSLPKMKFLIVLSVILAISAAELQLSDEQKAVAHANGALCA QQEGITKDQAIALRNGNFDDSDPKVKCFANCFLEKIGFLINGEVQPDVVL AKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECYYKNRAHI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp56d-PB | 131 | CG11218-PB | 1..131 | 15..145 | 673 | 100 | Plus |
Obp56d-PA | 131 | CG11218-PA | 1..131 | 15..145 | 673 | 100 | Plus |
Obp56e-PB | 131 | CG8462-PB | 1..129 | 15..143 | 448 | 64.3 | Plus |
Obp56e-PA | 132 | CG8462-PA | 1..130 | 15..143 | 439 | 63.8 | Plus |
Obp56a-PA | 139 | CG11797-PA | 5..128 | 17..138 | 265 | 42.7 | Plus |
Translation from 45 to 440
> RE22207.pep MKFLIVLSVILAISAAELQLSDEQKAVAHANGALCAQQEGITKDQAIALR NGNFDDSDPKVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKA VQAKCDATKGADKCDTAYQLFECYYKNRAHI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF13167-PA | 131 | GF13167-PA | 1..131 | 1..131 | 566 | 79.4 | Plus |
Dana\GF11735-PA | 130 | GF11735-PA | 1..130 | 1..131 | 445 | 63.4 | Plus |
Dana\GF11734-PA | 136 | GF11734-PA | 9..128 | 4..124 | 250 | 42.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20889-PA | 131 | GG20889-PA | 1..131 | 1..131 | 635 | 92.4 | Plus |
Dere\GG21996-PA | 132 | GG21996-PA | 4..132 | 3..131 | 419 | 61.2 | Plus |
Dere\GG21994-PA | 139 | GG21994-PA | 5..128 | 3..124 | 253 | 43.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH22760-PA | 132 | GH22760-PA | 1..132 | 1..131 | 406 | 59.8 | Plus |
Dgri\GH23017-PA | 132 | GH23017-PA | 1..128 | 1..128 | 322 | 47.7 | Plus |
Dgri\GH23015-PA | 138 | GH23015-PA | 5..128 | 3..124 | 233 | 38.7 | Plus |
Dgri\GH23016-PA | 135 | GH23016-PA | 5..128 | 3..126 | 218 | 36.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Obp56d-PB | 131 | CG11218-PB | 1..131 | 1..131 | 673 | 100 | Plus |
Obp56d-PA | 131 | CG11218-PA | 1..131 | 1..131 | 673 | 100 | Plus |
Obp56e-PB | 131 | CG8462-PB | 1..129 | 1..129 | 448 | 64.3 | Plus |
Obp56e-PA | 132 | CG8462-PA | 1..130 | 1..129 | 439 | 63.8 | Plus |
Obp56a-PA | 139 | CG11797-PA | 5..128 | 3..124 | 265 | 42.7 | Plus |
Obp56i-PA | 140 | CG30448-PA | 19..121 | 35..124 | 136 | 32 | Plus |
Obp56i-PB | 129 | CG30448-PB | 19..110 | 35..124 | 135 | 35.1 | Plus |
Obp56g-PA | 131 | CG13873-PA | 1..127 | 1..124 | 135 | 26 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI18537-PA | 132 | GI18537-PA | 1..132 | 1..131 | 437 | 62.9 | Plus |
Dmoj\GI21083-PA | 130 | GI21083-PA | 1..129 | 1..130 | 387 | 56.2 | Plus |
Dmoj\GI21082-PA | 138 | GI21082-PA | 9..128 | 4..124 | 238 | 39.7 | Plus |
Dmoj\GI18535-PA | 135 | GI18535-PA | 33..128 | 35..127 | 137 | 35.7 | Plus |
Dmoj\GI13005-PA | 147 | GI13005-PA | 42..135 | 35..129 | 136 | 31.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11722-PA | 131 | GL11722-PA | 1..131 | 1..131 | 537 | 74.8 | Plus |
Dper\GL10359-PA | 130 | GL10359-PA | 17..130 | 18..131 | 421 | 64.9 | Plus |
Dper\GL10358-PA | 137 | GL10358-PA | 5..128 | 3..124 | 256 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\Obp56d-PA | 131 | GA10849-PA | 1..131 | 1..131 | 537 | 74.8 | Plus |
Dpse\Obp56e-PA | 130 | GA21096-PA | 17..130 | 18..131 | 424 | 65.8 | Plus |
Dpse\Obp56a-PA | 137 | GA11204-PA | 5..128 | 3..124 | 254 | 42.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM23170-PA | 131 | GM23170-PA | 1..131 | 1..131 | 661 | 96.2 | Plus |
Dsec\Obp56e-PA | 119 | GM23181-PA | 21..119 | 20..131 | 343 | 60.7 | Plus |
Dsec\GM21981-PA | 139 | GM21981-PA | 5..128 | 3..124 | 255 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\Obp56d-PA | 131 | GD15213-PA | 1..131 | 1..131 | 661 | 96.2 | Plus |
Dsim\Obp56e-PA | 132 | GD11478-PA | 21..132 | 20..131 | 435 | 71.4 | Plus |
Dsim\Obp56a-PA | 139 | GD11477-PA | 5..128 | 3..124 | 257 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\Obp56d-PA | 132 | GJ21407-PA | 1..132 | 1..131 | 421 | 68.2 | Plus |
Dvir\Obp56eL1-PA | 130 | GJ20932-PA | 1..128 | 1..129 | 359 | 51.2 | Plus |
Dvir\Obp56a-PA | 138 | GJ20931-PA | 5..128 | 3..124 | 246 | 40.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK15692-PA | 132 | GK15692-PA | 1..132 | 1..131 | 511 | 78 | Plus |
Dwil\GK15691-PA | 132 | GK15691-PA | 1..132 | 1..131 | 453 | 61.4 | Plus |
Dwil\GK15889-PA | 139 | GK15889-PA | 5..128 | 3..124 | 278 | 46 | Plus |
Dwil\GK15894-PA | 138 | GK15894-PA | 33..132 | 35..131 | 134 | 34 | Plus |
Dwil\GK15687-PA | 138 | GK15687-PA | 33..132 | 35..131 | 134 | 34 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13830-PA | 131 | GE13830-PA | 1..131 | 1..131 | 649 | 93.9 | Plus |
Dyak\Obp56e-PA | 132 | GE12075-PA | 1..132 | 1..131 | 439 | 64.9 | Plus |
Dyak\GE12074-PA | 139 | GE12074-PA | 5..128 | 3..124 | 249 | 41.9 | Plus |