Clone RE22207 Report

Search the DGRC for RE22207

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:222
Well:7
Vector:pFlc-1
Associated Gene/TranscriptObp56d-RA
Protein status:RE22207.pep: gold
Sequenced Size:585

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11218 2002-01-01 Sim4 clustering to Release 2
CG11218 2002-04-21 Blastp of sequenced clone
CG11218 2003-01-01 Sim4 clustering to Release 3
Obp56d 2008-04-29 Release 5.5 accounting
Obp56d 2008-08-15 Release 5.9 accounting
Obp56d 2008-12-18 5.12 accounting

Clone Sequence Records

RE22207.complete Sequence

585 bp (585 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113425

> RE22207.complete
AGCGGTTTCGATACCAAAGGGTTTCCAACAACATCTCTACCGAAAATGAA
GTTCCTGATTGTCCTCTCCGTCATTTTGGCCATTTCGGCTGCTGAGCTGC
AACTATCCGATGAGCAGAAGGCTGTGGCCCATGCCAATGGCGCCCTTTGT
GCCCAGCAGGAGGGAATCACCAAGGATCAGGCGATCGCCTTGCGAAACGG
CAATTTCGATGACAGTGACCCCAAGGTGAAATGCTTCGCCAATTGTTTCT
TGGAGAAAATCGGATTCCTGATCAATGGTGAGGTCCAGCCCGATGTCGTT
CTGGCCAAGTTGGGACCCCTGGCCGGCGAGGATGCCGTGAAGGCCGTTCA
GGCCAAGTGTGATGCCACCAAGGGAGCGGATAAGTGCGATACTGCCTATC
AGCTATTCGAGTGCTACTACAAGAATCGCGCCCACATCTAAGCGCCAAAT
CTCCGATATTCTCCTGTGTGATAATCTGTCTGTGACTTGTTACTTATATT
GTTTTAATTCAGTATATCAATTCGTAAACAAAATTTTTAGATCTGTAAAT
GTTTTGAATAATAAACTCAAGAAAAAAAAAAAAAA

RE22207.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:48:13
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56d-RA 811 Obp56d-RA 145..713 5..573 2845 100 Plus
Obp56e-RA 734 Obp56e-RA 479..572 349..442 200 80.8 Plus
nc_8077.a 1204 nc_8077.a 353..446 349..442 200 80.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:48:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15590363..15590840 571..94 2375 99.8 Minus
chr2R 21145070 chr2R 15590910..15590999 94..5 450 100 Minus
chr2R 21145070 chr2R 15599773..15600058 157..442 275 73.1 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:07 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:48:31
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19703153..19703632 573..94 2400 100 Minus
2R 25286936 2R 19703702..19703791 94..5 450 100 Minus
2R 25286936 2R 19712567..19712852 157..442 260 72.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:08:06
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19704352..19704831 573..94 2400 100 Minus
2R 25260384 2R 19704901..19704990 94..5 450 100 Minus
2R 25260384 2R 19713958..19714051 349..442 200 80.8 Plus
Blast to na_te.dros performed on 2019-03-16 12:48:32 has no hits.

RE22207.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:49:37 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15590363..15590840 94..571 99 <- Minus
chr2R 15590911..15591002 1..93 97   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:17 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..396 46..441 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:42:46 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..396 46..441 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:29:46 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..396 46..441 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:21:44 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..396 46..441 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:56:22 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..396 46..441 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:50:01 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..571 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:42:45 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..571 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:29:46 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 5..575 1..571 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:21:45 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 1..571 1..571 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:56:22 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
Obp56d-RA 5..575 1..571 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:37 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19703155..19703632 94..571 100 <- Minus
2R 19703703..19703794 1..93 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:37 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19703155..19703632 94..571 100 <- Minus
2R 19703703..19703794 1..93 97   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:37 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19703155..19703632 94..571 100 <- Minus
2R 19703703..19703794 1..93 97   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:29:46 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15590660..15591137 94..571 100 <- Minus
arm_2R 15591208..15591299 1..93 97   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:56:21 Download gff for RE22207.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19704354..19704831 94..571 100 <- Minus
2R 19704902..19704993 1..93 97   Minus

RE22207.hyp Sequence

Translation from 3 to 440

> RE22207.hyp
SFDTKGFPTTSLPKMKFLIVLSVILAISAAELQLSDEQKAVAHANGALCA
QQEGITKDQAIALRNGNFDDSDPKVKCFANCFLEKIGFLINGEVQPDVVL
AKLGPLAGEDAVKAVQAKCDATKGADKCDTAYQLFECYYKNRAHI*

RE22207.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:05:06
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56d-PB 131 CG11218-PB 1..131 15..145 673 100 Plus
Obp56d-PA 131 CG11218-PA 1..131 15..145 673 100 Plus
Obp56e-PB 131 CG8462-PB 1..129 15..143 448 64.3 Plus
Obp56e-PA 132 CG8462-PA 1..130 15..143 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 5..128 17..138 265 42.7 Plus

RE22207.pep Sequence

Translation from 45 to 440

> RE22207.pep
MKFLIVLSVILAISAAELQLSDEQKAVAHANGALCAQQEGITKDQAIALR
NGNFDDSDPKVKCFANCFLEKIGFLINGEVQPDVVLAKLGPLAGEDAVKA
VQAKCDATKGADKCDTAYQLFECYYKNRAHI*

RE22207.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:26:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13167-PA 131 GF13167-PA 1..131 1..131 566 79.4 Plus
Dana\GF11735-PA 130 GF11735-PA 1..130 1..131 445 63.4 Plus
Dana\GF11734-PA 136 GF11734-PA 9..128 4..124 250 42.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20889-PA 131 GG20889-PA 1..131 1..131 635 92.4 Plus
Dere\GG21996-PA 132 GG21996-PA 4..132 3..131 419 61.2 Plus
Dere\GG21994-PA 139 GG21994-PA 5..128 3..124 253 43.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:26:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22760-PA 132 GH22760-PA 1..132 1..131 406 59.8 Plus
Dgri\GH23017-PA 132 GH23017-PA 1..128 1..128 322 47.7 Plus
Dgri\GH23015-PA 138 GH23015-PA 5..128 3..124 233 38.7 Plus
Dgri\GH23016-PA 135 GH23016-PA 5..128 3..126 218 36.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:53
Subject Length Description Subject Range Query Range Score Percent Strand
Obp56d-PB 131 CG11218-PB 1..131 1..131 673 100 Plus
Obp56d-PA 131 CG11218-PA 1..131 1..131 673 100 Plus
Obp56e-PB 131 CG8462-PB 1..129 1..129 448 64.3 Plus
Obp56e-PA 132 CG8462-PA 1..130 1..129 439 63.8 Plus
Obp56a-PA 139 CG11797-PA 5..128 3..124 265 42.7 Plus
Obp56i-PA 140 CG30448-PA 19..121 35..124 136 32 Plus
Obp56i-PB 129 CG30448-PB 19..110 35..124 135 35.1 Plus
Obp56g-PA 131 CG13873-PA 1..127 1..124 135 26 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18537-PA 132 GI18537-PA 1..132 1..131 437 62.9 Plus
Dmoj\GI21083-PA 130 GI21083-PA 1..129 1..130 387 56.2 Plus
Dmoj\GI21082-PA 138 GI21082-PA 9..128 4..124 238 39.7 Plus
Dmoj\GI18535-PA 135 GI18535-PA 33..128 35..127 137 35.7 Plus
Dmoj\GI13005-PA 147 GI13005-PA 42..135 35..129 136 31.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:26:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11722-PA 131 GL11722-PA 1..131 1..131 537 74.8 Plus
Dper\GL10359-PA 130 GL10359-PA 17..130 18..131 421 64.9 Plus
Dper\GL10358-PA 137 GL10358-PA 5..128 3..124 256 42.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\Obp56d-PA 131 GA10849-PA 1..131 1..131 537 74.8 Plus
Dpse\Obp56e-PA 130 GA21096-PA 17..130 18..131 424 65.8 Plus
Dpse\Obp56a-PA 137 GA11204-PA 5..128 3..124 254 42.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:26:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23170-PA 131 GM23170-PA 1..131 1..131 661 96.2 Plus
Dsec\Obp56e-PA 119 GM23181-PA 21..119 20..131 343 60.7 Plus
Dsec\GM21981-PA 139 GM21981-PA 5..128 3..124 255 44 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:26:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\Obp56d-PA 131 GD15213-PA 1..131 1..131 661 96.2 Plus
Dsim\Obp56e-PA 132 GD11478-PA 21..132 20..131 435 71.4 Plus
Dsim\Obp56a-PA 139 GD11477-PA 5..128 3..124 257 44 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\Obp56d-PA 132 GJ21407-PA 1..132 1..131 421 68.2 Plus
Dvir\Obp56eL1-PA 130 GJ20932-PA 1..128 1..129 359 51.2 Plus
Dvir\Obp56a-PA 138 GJ20931-PA 5..128 3..124 246 40.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:26:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15692-PA 132 GK15692-PA 1..132 1..131 511 78 Plus
Dwil\GK15691-PA 132 GK15691-PA 1..132 1..131 453 61.4 Plus
Dwil\GK15889-PA 139 GK15889-PA 5..128 3..124 278 46 Plus
Dwil\GK15894-PA 138 GK15894-PA 33..132 35..131 134 34 Plus
Dwil\GK15687-PA 138 GK15687-PA 33..132 35..131 134 34 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:26:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13830-PA 131 GE13830-PA 1..131 1..131 649 93.9 Plus
Dyak\Obp56e-PA 132 GE12075-PA 1..132 1..131 439 64.9 Plus
Dyak\GE12074-PA 139 GE12074-PA 5..128 3..124 249 41.9 Plus