Clone RE22290 Report

Search the DGRC for RE22290

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:222
Well:90
Vector:pFlc-1
Associated Gene/TranscriptCG7330-RA
Protein status:RE22290.pep: gold
Preliminary Size:682
Sequenced Size:1000

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7330 2002-01-01 Sim4 clustering to Release 2
CG7330 2002-04-22 Blastp of sequenced clone
CG7330 2003-01-01 Sim4 clustering to Release 3
CG7330 2008-04-29 Release 5.5 accounting
CG7330 2008-08-15 Release 5.9 accounting
CG7330 2008-12-18 5.12 accounting

Clone Sequence Records

RE22290.complete Sequence

1000 bp (1000 high quality bases) assembled on 2002-04-22

GenBank Submission: AY113426

> RE22290.complete
GAGGCAGTCGAAGACTTTAAGCGCACCAAGTCGCCTGCCGCTCCACTCCA
AAAAATACGAGACTTTCGGAGACCCGCAACACACAGTGGTGTTACGATAT
ATTACCCAACATTTGGCGGCCATGAATCTGCGGTATATCTGCACTGTGGC
TCTCGTGCCAACGCTCTGCGTGCTGCTGGTGCTTCTGCTGGAATTCGTGG
AGGAGGGCCTGGCCCAGAATTCCGATCCCCTTTTCGAGCTTCCCGTCCAG
CTGGTCGGCTTCCCCGTAATCGTGCTATCCGTCCGCCTGTCCCAGTTCGC
CAAGAAGTTGGCCTACTCCCTCAGTCCCAGTACATATAGATCTCGCACCA
GAAGGGATACGGCTCATCCTCTGGCTCTTGATGCTGAACTGGCCCAGAAA
CAGATACTGGGTGAGTTCGGACCCCAAGCCTGCATCCTGGAGGAGCCGTG
CCGTGTCCATGCCTCTAGATACTCAGGCAGTTCTGATGGCCGCTTTCCTG
ATGGAAAAGCAAAGCCACATGCTGCCTGGTCGGAAGTGTTGCGGAACTAC
AAAGTGCAATCGGGCGTCAGTGGGATGAAGCAATGGTACCTTCTATCCCT
GTTCATCGGCGATGCTGTGCGGGATGTGCCGCTGTGCAAGCACCTGGCCA
AAAGGATGCCGTGTCCAGGAGTCGGACCTCTGCCGGCGCCCCAACCACGA
TGAAGATCTGAACGGATCCGCCTCCTCAGGGGCATTTCGTATCGAGGAGG
GAGCAGGAGCATCCGGATGGAGTCCCCTTAGTCAGTCGCATCGGACATCT
TTGTTAATCATCCATCTCTCGGCACTCACATCCAGCTGCCATGTGCTGTC
CTTGTACACCACATCATTTTGTTGTACTTTTAGTTGATTTTAAGGGTTTT
AATTTAAACGAACGACCGCCAACAGACGTAGGCGCTTAGATTTATGAGTA
AGCAAATAAATAAACAAACCAGTTGGAAAAAACCAAAAAAAAAAAAAAAA

RE22290.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG7330-RA 1123 CG7330-RA 138..1119 5..986 4895 99.8 Plus
CG7330.a 1297 CG7330.a 138..1119 5..986 4895 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:39:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 18142834..18143273 543..982 2200 100 Plus
chr3L 24539361 chr3L 18138581..18138908 5..332 1640 100 Plus
chr3L 24539361 chr3L 18140326..18140537 330..541 1060 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18153186..18153629 543..986 2205 99.8 Plus
3L 28110227 3L 18148929..18149256 5..332 1640 100 Plus
3L 28110227 3L 18150677..18150891 330..544 1075 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:43:40
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 18146286..18146729 543..986 2205 99.7 Plus
3L 28103327 3L 18142029..18142356 5..332 1640 100 Plus
3L 28103327 3L 18143777..18143991 330..544 1075 100 Plus
Blast to na_te.dros performed 2019-03-16 22:39:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmir\worf 4174 Dmir\worf WORF 4174bp Derived from AY144572. 4051..4174 844..968 109 57.5 Plus

RE22290.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:39:50 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 18138577..18138905 1..329 99 -> Plus
chr3L 18140326..18140539 330..543 99 -> Plus
chr3L 18142835..18143275 544..984 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:23 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 1..582 122..703 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:58:58 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 1..582 122..703 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:15:54 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 1..582 122..703 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:52:15 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 1..582 122..703 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:41:27 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 1..582 122..703 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:39:32 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 2..981 2..981 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:58:58 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 2..981 2..981 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:15:54 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 3..986 1..984 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:52:15 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 2..981 2..981 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:41:27 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
CG7330-RA 3..986 1..984 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:50 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18148925..18149253 1..329 99 -> Plus
3L 18150677..18150890 330..543 100 -> Plus
3L 18153187..18153627 544..984 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:50 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18148925..18149253 1..329 99 -> Plus
3L 18150677..18150890 330..543 100 -> Plus
3L 18153187..18153627 544..984 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:39:50 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18148925..18149253 1..329 99 -> Plus
3L 18150677..18150890 330..543 100 -> Plus
3L 18153187..18153627 544..984 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:15:54 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18142025..18142353 1..329 99 -> Plus
arm_3L 18143777..18143990 330..543 100 -> Plus
arm_3L 18146287..18146727 544..984 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:24:21 Download gff for RE22290.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18142025..18142353 1..329 99 -> Plus
3L 18143777..18143990 330..543 100 -> Plus
3L 18146287..18146727 544..984 99   Plus

RE22290.hyp Sequence

Translation from 0 to 702

> RE22290.hyp
SQSKTLSAPSRLPLHSKKYETFGDPQHTVVLRYITQHLAAMNLRYICTVA
LVPTLCVLLVLLLEFVEEGLAQNSDPLFELPVQLVGFPVIVLSVRLSQFA
KKLAYSLSPSTYRSRTRRDTAHPLALDAELAQKQILGEFGPQACILEEPC
RVHASRYSGSSDGRFPDGKAKPHAAWSEVLRNYKVQSGVSGMKQWYLLSL
FIGDAVRDVPLCKHLAKRMPCPGVGPLPAPQPR*

RE22290.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:34:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG7330-PB 193 CG7330-PB 1..193 41..233 1007 100 Plus
CG7330-PA 193 CG7330-PA 1..193 41..233 1007 100 Plus

RE22290.pep Sequence

Translation from 121 to 702

> RE22290.pep
MNLRYICTVALVPTLCVLLVLLLEFVEEGLAQNSDPLFELPVQLVGFPVI
VLSVRLSQFAKKLAYSLSPSTYRSRTRRDTAHPLALDAELAQKQILGEFG
PQACILEEPCRVHASRYSGSSDGRFPDGKAKPHAAWSEVLRNYKVQSGVS
GMKQWYLLSLFIGDAVRDVPLCKHLAKRMPCPGVGPLPAPQPR*

RE22290.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:28:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23617-PA 194 GF23617-PA 1..194 1..193 791 87.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:28:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13655-PA 193 GG13655-PA 1..193 1..193 992 97.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14450-PA 191 GH14450-PA 1..191 1..193 722 83.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:03:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG7330-PB 193 CG7330-PB 1..193 1..193 1007 100 Plus
CG7330-PA 193 CG7330-PA 1..193 1..193 1007 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:28:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13585-PA 191 GI13585-PA 1..191 1..193 729 78.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22866-PA 403 GL22866-PA 1..106 1..105 339 85.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:28:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20266-PA 194 GA20266-PA 1..194 1..193 774 89.2 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14968-PA 193 GM14968-PA 1..193 1..193 1004 99 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:28:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14748-PA 193 GD14748-PA 1..193 1..193 1009 99.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13923-PA 191 GJ13923-PA 1..191 1..193 739 83.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:28:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK11111-PA 196 GK11111-PA 1..196 1..193 750 84.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:28:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE19951-PA 193 GE19951-PA 1..193 1..193 995 97.9 Plus