BDGP Sequence Production Resources |
Search the DGRC for RE22290
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 222 |
Well: | 90 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG7330-RA |
Protein status: | RE22290.pep: gold |
Preliminary Size: | 682 |
Sequenced Size: | 1000 |
Gene | Date | Evidence |
---|---|---|
CG7330 | 2002-01-01 | Sim4 clustering to Release 2 |
CG7330 | 2002-04-22 | Blastp of sequenced clone |
CG7330 | 2003-01-01 | Sim4 clustering to Release 3 |
CG7330 | 2008-04-29 | Release 5.5 accounting |
CG7330 | 2008-08-15 | Release 5.9 accounting |
CG7330 | 2008-12-18 | 5.12 accounting |
1000 bp (1000 high quality bases) assembled on 2002-04-22
GenBank Submission: AY113426
> RE22290.complete GAGGCAGTCGAAGACTTTAAGCGCACCAAGTCGCCTGCCGCTCCACTCCA AAAAATACGAGACTTTCGGAGACCCGCAACACACAGTGGTGTTACGATAT ATTACCCAACATTTGGCGGCCATGAATCTGCGGTATATCTGCACTGTGGC TCTCGTGCCAACGCTCTGCGTGCTGCTGGTGCTTCTGCTGGAATTCGTGG AGGAGGGCCTGGCCCAGAATTCCGATCCCCTTTTCGAGCTTCCCGTCCAG CTGGTCGGCTTCCCCGTAATCGTGCTATCCGTCCGCCTGTCCCAGTTCGC CAAGAAGTTGGCCTACTCCCTCAGTCCCAGTACATATAGATCTCGCACCA GAAGGGATACGGCTCATCCTCTGGCTCTTGATGCTGAACTGGCCCAGAAA CAGATACTGGGTGAGTTCGGACCCCAAGCCTGCATCCTGGAGGAGCCGTG CCGTGTCCATGCCTCTAGATACTCAGGCAGTTCTGATGGCCGCTTTCCTG ATGGAAAAGCAAAGCCACATGCTGCCTGGTCGGAAGTGTTGCGGAACTAC AAAGTGCAATCGGGCGTCAGTGGGATGAAGCAATGGTACCTTCTATCCCT GTTCATCGGCGATGCTGTGCGGGATGTGCCGCTGTGCAAGCACCTGGCCA AAAGGATGCCGTGTCCAGGAGTCGGACCTCTGCCGGCGCCCCAACCACGA TGAAGATCTGAACGGATCCGCCTCCTCAGGGGCATTTCGTATCGAGGAGG GAGCAGGAGCATCCGGATGGAGTCCCCTTAGTCAGTCGCATCGGACATCT TTGTTAATCATCCATCTCTCGGCACTCACATCCAGCTGCCATGTGCTGTC CTTGTACACCACATCATTTTGTTGTACTTTTAGTTGATTTTAAGGGTTTT AATTTAAACGAACGACCGCCAACAGACGTAGGCGCTTAGATTTATGAGTA AGCAAATAAATAAACAAACCAGTTGGAAAAAACCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 18142834..18143273 | 543..982 | 2200 | 100 | Plus |
chr3L | 24539361 | chr3L | 18138581..18138908 | 5..332 | 1640 | 100 | Plus |
chr3L | 24539361 | chr3L | 18140326..18140537 | 330..541 | 1060 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 18153186..18153629 | 543..986 | 2205 | 99.8 | Plus |
3L | 28110227 | 3L | 18148929..18149256 | 5..332 | 1640 | 100 | Plus |
3L | 28110227 | 3L | 18150677..18150891 | 330..544 | 1075 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 18146286..18146729 | 543..986 | 2205 | 99.7 | Plus |
3L | 28103327 | 3L | 18142029..18142356 | 5..332 | 1640 | 100 | Plus |
3L | 28103327 | 3L | 18143777..18143991 | 330..544 | 1075 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmir\worf | 4174 | Dmir\worf WORF 4174bp Derived from AY144572. | 4051..4174 | 844..968 | 109 | 57.5 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 18138577..18138905 | 1..329 | 99 | -> | Plus |
chr3L | 18140326..18140539 | 330..543 | 99 | -> | Plus |
chr3L | 18142835..18143275 | 544..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 1..582 | 122..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 1..582 | 122..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 1..582 | 122..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 1..582 | 122..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 1..582 | 122..703 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 2..981 | 2..981 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 2..981 | 2..981 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 3..986 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 2..981 | 2..981 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG7330-RA | 3..986 | 1..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18148925..18149253 | 1..329 | 99 | -> | Plus |
3L | 18150677..18150890 | 330..543 | 100 | -> | Plus |
3L | 18153187..18153627 | 544..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18148925..18149253 | 1..329 | 99 | -> | Plus |
3L | 18150677..18150890 | 330..543 | 100 | -> | Plus |
3L | 18153187..18153627 | 544..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18148925..18149253 | 1..329 | 99 | -> | Plus |
3L | 18150677..18150890 | 330..543 | 100 | -> | Plus |
3L | 18153187..18153627 | 544..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 18142025..18142353 | 1..329 | 99 | -> | Plus |
arm_3L | 18143777..18143990 | 330..543 | 100 | -> | Plus |
arm_3L | 18146287..18146727 | 544..984 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 18142025..18142353 | 1..329 | 99 | -> | Plus |
3L | 18143777..18143990 | 330..543 | 100 | -> | Plus |
3L | 18146287..18146727 | 544..984 | 99 | Plus |
Translation from 0 to 702
> RE22290.hyp SQSKTLSAPSRLPLHSKKYETFGDPQHTVVLRYITQHLAAMNLRYICTVA LVPTLCVLLVLLLEFVEEGLAQNSDPLFELPVQLVGFPVIVLSVRLSQFA KKLAYSLSPSTYRSRTRRDTAHPLALDAELAQKQILGEFGPQACILEEPC RVHASRYSGSSDGRFPDGKAKPHAAWSEVLRNYKVQSGVSGMKQWYLLSL FIGDAVRDVPLCKHLAKRMPCPGVGPLPAPQPR*
Translation from 121 to 702
> RE22290.pep MNLRYICTVALVPTLCVLLVLLLEFVEEGLAQNSDPLFELPVQLVGFPVI VLSVRLSQFAKKLAYSLSPSTYRSRTRRDTAHPLALDAELAQKQILGEFG PQACILEEPCRVHASRYSGSSDGRFPDGKAKPHAAWSEVLRNYKVQSGVS GMKQWYLLSLFIGDAVRDVPLCKHLAKRMPCPGVGPLPAPQPR*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF23617-PA | 194 | GF23617-PA | 1..194 | 1..193 | 791 | 87.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG13655-PA | 193 | GG13655-PA | 1..193 | 1..193 | 992 | 97.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH14450-PA | 191 | GH14450-PA | 1..191 | 1..193 | 722 | 83.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG7330-PB | 193 | CG7330-PB | 1..193 | 1..193 | 1007 | 100 | Plus |
CG7330-PA | 193 | CG7330-PA | 1..193 | 1..193 | 1007 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI13585-PA | 191 | GI13585-PA | 1..191 | 1..193 | 729 | 78.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL22866-PA | 403 | GL22866-PA | 1..106 | 1..105 | 339 | 85.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA20266-PA | 194 | GA20266-PA | 1..194 | 1..193 | 774 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM14968-PA | 193 | GM14968-PA | 1..193 | 1..193 | 1004 | 99 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14748-PA | 193 | GD14748-PA | 1..193 | 1..193 | 1009 | 99.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ13923-PA | 191 | GJ13923-PA | 1..191 | 1..193 | 739 | 83.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK11111-PA | 196 | GK11111-PA | 1..196 | 1..193 | 750 | 84.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE19951-PA | 193 | GE19951-PA | 1..193 | 1..193 | 995 | 97.9 | Plus |