BDGP Sequence Production Resources |
Search the DGRC for RE22315
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 223 |
Well: | 15 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11555-RA |
Protein status: | RE22315.pep: gold |
Preliminary Size: | 972 |
Sequenced Size: | 827 |
Gene | Date | Evidence |
---|---|---|
CG11555 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11555 | 2002-02-22 | Blastp of sequenced clone |
CG11555 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11555 | 2008-04-29 | Release 5.5 accounting |
CG11555 | 2008-08-15 | Release 5.9 accounting |
CG11555 | 2008-12-18 | 5.12 accounting |
827 bp (827 high quality bases) assembled on 2002-02-22
GenBank Submission: AY084136
> RE22315.complete GATATTCAGTTTAACCACAAATAACAACGCTATGAATTCTACCAATCCGA AGAAAACAGAAGATAATGATCGCCATGAACGTCAATTGCAGAGCCGCACC AAGGACTGGGGCAAAACCAAGTTCAAGCCAAAGAAGTATGTCCAACCGAA ACCAGCGCTCGTTCCACAAGCTACTGCGACGCCCTGGCAGCATGTGAAGA ACGACATAATTACGGATTCTTCGGACCGGGGACACCAGGATGTGGACAGC GAGGACGCAAGGCAGTTCATGCAGCAGCGTCAGAAGAACCACCGTCGAAA TGTCATAGAAGCCAACCGGTCGCAGGATACTACATGGGAGCCCTTCAACG ATGAGAAGCCCTCCACGGAAAGAAAACAACAGCTCTCCACGGACGTTGAG AACTTCACTTTTAAGGAGCGGAACTTTTTCCGAAAGCAACTCACTTTGGG TTTCAATTTAACGAAAAAGAATGCAACACTTAAATCTGCCCTAAAGGACT TGAAATATAGACAGCTGACAAAGGACAAGTTCGAATTAGAACGTTCGAAT CATACACGTCGAAATGTGAAATCATCAAATGCGAAAGAAGCAAAGGGTAG CCATCCCTTTCAGAAAATGCGAGATAATGCACATCCTTATCGAAAGAAGG GACCAAATAGGAGAAATCCGTTTCAGAAAGGGCCACATAATGAATAAGTT TAGCTTATTTTCCCTTAGGTGACTTCACAACCCCAACTGGCAAAACATGA AGTTTCAATTAAAAAATAAATAAAAGATTCTTTGTCGGGTGACAAATCAG AAATGTATACGCAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 273988..274797 | 1..810 | 4050 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 273955..274768 | 1..814 | 4055 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 273955..274768 | 1..814 | 4055 | 99.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 273988..274799 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..666 | 32..697 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..666 | 32..697 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..666 | 32..697 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..666 | 32..697 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..666 | 32..697 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..812 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..812 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 19..830 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 1..812 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11555-RA | 19..830 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 273955..274766 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 273955..274766 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 273955..274766 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 273955..274766 | 1..812 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 273955..274766 | 1..812 | 99 | Plus |
Translation from 0 to 696
> RE22315.hyp IFSLTTNNNAMNSTNPKKTEDNDRHERQLQSRTKDWGKTKFKPKKYVQPK PALVPQATATPWQHVKNDIITDSSDRGHQDVDSEDARQFMQQRQKNHRRN VIEANRSQDTTWEPFNDEKPSTERKQQLSTDVENFTFKERNFFRKQLTLG FNLTKKNATLKSALKDLKYRQLTKDKFELERSNHTRRNVKSSNAKEAKGS HPFQKMRDNAHPYRKKGPNRRNPFQKGPHNE*
Translation from 31 to 696
> RE22315.pep MNSTNPKKTEDNDRHERQLQSRTKDWGKTKFKPKKYVQPKPALVPQATAT PWQHVKNDIITDSSDRGHQDVDSEDARQFMQQRQKNHRRNVIEANRSQDT TWEPFNDEKPSTERKQQLSTDVENFTFKERNFFRKQLTLGFNLTKKNATL KSALKDLKYRQLTKDKFELERSNHTRRNVKSSNAKEAKGSHPFQKMRDNA HPYRKKGPNRRNPFQKGPHNE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF21765-PA | 202 | GF21765-PA | 3..172 | 9..157 | 332 | 45.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG24707-PA | 219 | GG24707-PA | 1..215 | 1..217 | 750 | 68.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11545-PA | 201 | GH11545-PA | 10..178 | 12..158 | 269 | 34.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11555-PB | 221 | CG11555-PB | 1..221 | 1..221 | 1186 | 100 | Plus |
CG11555-PA | 221 | CG11555-PA | 1..221 | 1..221 | 1186 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI17034-PA | 174 | GI17034-PA | 1..161 | 1..159 | 294 | 39.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25918-PA | 226 | GL25918-PA | 6..221 | 15..216 | 359 | 37.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11063-PA | 218 | GA11063-PA | 2..213 | 19..216 | 355 | 37.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM16728-PA | 221 | GM16728-PA | 1..221 | 1..221 | 1084 | 92.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD23012-PA | 220 | GD23012-PA | 1..220 | 1..221 | 1061 | 91.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ24656-PA | 204 | GJ24656-PA | 16..173 | 15..158 | 297 | 42 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK21097-PA | 176 | GK21097-PA | 6..159 | 10..158 | 283 | 41.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE16692-PA | 205 | GE16692-PA | 6..201 | 13..217 | 684 | 65.4 | Plus |