Clone RE22315 Report

Search the DGRC for RE22315

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:223
Well:15
Vector:pFlc-1
Associated Gene/TranscriptCG11555-RA
Protein status:RE22315.pep: gold
Preliminary Size:972
Sequenced Size:827

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11555 2002-01-01 Sim4 clustering to Release 2
CG11555 2002-02-22 Blastp of sequenced clone
CG11555 2003-01-01 Sim4 clustering to Release 3
CG11555 2008-04-29 Release 5.5 accounting
CG11555 2008-08-15 Release 5.9 accounting
CG11555 2008-12-18 5.12 accounting

Clone Sequence Records

RE22315.complete Sequence

827 bp (827 high quality bases) assembled on 2002-02-22

GenBank Submission: AY084136

> RE22315.complete
GATATTCAGTTTAACCACAAATAACAACGCTATGAATTCTACCAATCCGA
AGAAAACAGAAGATAATGATCGCCATGAACGTCAATTGCAGAGCCGCACC
AAGGACTGGGGCAAAACCAAGTTCAAGCCAAAGAAGTATGTCCAACCGAA
ACCAGCGCTCGTTCCACAAGCTACTGCGACGCCCTGGCAGCATGTGAAGA
ACGACATAATTACGGATTCTTCGGACCGGGGACACCAGGATGTGGACAGC
GAGGACGCAAGGCAGTTCATGCAGCAGCGTCAGAAGAACCACCGTCGAAA
TGTCATAGAAGCCAACCGGTCGCAGGATACTACATGGGAGCCCTTCAACG
ATGAGAAGCCCTCCACGGAAAGAAAACAACAGCTCTCCACGGACGTTGAG
AACTTCACTTTTAAGGAGCGGAACTTTTTCCGAAAGCAACTCACTTTGGG
TTTCAATTTAACGAAAAAGAATGCAACACTTAAATCTGCCCTAAAGGACT
TGAAATATAGACAGCTGACAAAGGACAAGTTCGAATTAGAACGTTCGAAT
CATACACGTCGAAATGTGAAATCATCAAATGCGAAAGAAGCAAAGGGTAG
CCATCCCTTTCAGAAAATGCGAGATAATGCACATCCTTATCGAAAGAAGG
GACCAAATAGGAGAAATCCGTTTCAGAAAGGGCCACATAATGAATAAGTT
TAGCTTATTTTCCCTTAGGTGACTTCACAACCCCAACTGGCAAAACATGA
AGTTTCAATTAAAAAATAAATAAAAGATTCTTTGTCGGGTGACAAATCAG
AAATGTATACGCAAAAAAAAAAAAAAA

RE22315.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG11555-RA 812 CG11555-RA 1..810 1..810 4050 100 Plus
mbm-RA 2159 mbm-RA 1..142 142..1 710 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:56:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 273988..274797 1..810 4050 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:15 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:56:35
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 273955..274768 1..814 4055 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 273955..274768 1..814 4055 99.8 Plus
Blast to na_te.dros performed on 2019-03-16 18:56:35 has no hits.

RE22315.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 18:57:16 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 273988..274799 1..812 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:26 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:39:02 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:20:00 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:12 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:56:08 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..666 32..697 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:07 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..812 1..812 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:39:02 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..812 1..812 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:20:00 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 19..830 1..812 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:12 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 1..812 1..812 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:56:08 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
CG11555-RA 19..830 1..812 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:16 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
2L 273955..274766 1..812 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:16 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
2L 273955..274766 1..812 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 18:57:16 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
2L 273955..274766 1..812 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:20:00 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 273955..274766 1..812 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:22 Download gff for RE22315.complete
Subject Subject Range Query Range Percent Splice Strand
2L 273955..274766 1..812 99   Plus

RE22315.hyp Sequence

Translation from 0 to 696

> RE22315.hyp
IFSLTTNNNAMNSTNPKKTEDNDRHERQLQSRTKDWGKTKFKPKKYVQPK
PALVPQATATPWQHVKNDIITDSSDRGHQDVDSEDARQFMQQRQKNHRRN
VIEANRSQDTTWEPFNDEKPSTERKQQLSTDVENFTFKERNFFRKQLTLG
FNLTKKNATLKSALKDLKYRQLTKDKFELERSNHTRRNVKSSNAKEAKGS
HPFQKMRDNAHPYRKKGPNRRNPFQKGPHNE*

RE22315.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:50:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG11555-PB 221 CG11555-PB 1..221 11..231 1186 100 Plus
CG11555-PA 221 CG11555-PA 1..221 11..231 1186 100 Plus

RE22315.pep Sequence

Translation from 31 to 696

> RE22315.pep
MNSTNPKKTEDNDRHERQLQSRTKDWGKTKFKPKKYVQPKPALVPQATAT
PWQHVKNDIITDSSDRGHQDVDSEDARQFMQQRQKNHRRNVIEANRSQDT
TWEPFNDEKPSTERKQQLSTDVENFTFKERNFFRKQLTLGFNLTKKNATL
KSALKDLKYRQLTKDKFELERSNHTRRNVKSSNAKEAKGSHPFQKMRDNA
HPYRKKGPNRRNPFQKGPHNE*

RE22315.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:13:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21765-PA 202 GF21765-PA 3..172 9..157 332 45.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24707-PA 219 GG24707-PA 1..215 1..217 750 68.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11545-PA 201 GH11545-PA 10..178 12..158 269 34.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11555-PB 221 CG11555-PB 1..221 1..221 1186 100 Plus
CG11555-PA 221 CG11555-PA 1..221 1..221 1186 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17034-PA 174 GI17034-PA 1..161 1..159 294 39.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25918-PA 226 GL25918-PA 6..221 15..216 359 37.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11063-PA 218 GA11063-PA 2..213 19..216 355 37.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM16728-PA 221 GM16728-PA 1..221 1..221 1084 92.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD23012-PA 220 GD23012-PA 1..220 1..221 1061 91.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ24656-PA 204 GJ24656-PA 16..173 15..158 297 42 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK21097-PA 176 GK21097-PA 6..159 10..158 283 41.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE16692-PA 205 GE16692-PA 6..201 13..217 684 65.4 Plus