Clone RE22390 Report

Search the DGRC for RE22390

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:223
Well:90
Vector:pFlc-1
Associated Gene/Transcriptl(1)10Bb-RA
Protein status:RE22390.pep: gold
Preliminary Size:914
Sequenced Size:904

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG1639 2002-01-01 Sim4 clustering to Release 2
CG1639 2002-06-04 Blastp of sequenced clone
CG1639 2003-01-01 Sim4 clustering to Release 3
l(1)10Bb 2008-04-29 Release 5.5 accounting
l(1)10Bb 2008-08-15 Release 5.9 accounting
l(1)10Bb 2008-12-18 5.12 accounting

Clone Sequence Records

RE22390.complete Sequence

904 bp (904 high quality bases) assembled on 2002-06-04

GenBank Submission: AY118623

> RE22390.complete
AAAAGTGTCATCGCTAAGTAGCCAGCTGTTTGTGAAATGTTTGTTTTTCA
AGCAAAATTAAGCATTTTTAAGAGAAATTAAACAGTTTTACAGTTAAATA
AATTGAACATTTAAGATGCCCAAGGTTCGCCGCAGTCGCAAACCACCGCC
AGACGGTTGGGAGCTGATCGAACCAACTCTCGAGGAACTGGAGCAAAAAA
TGCGCGAAGCCGAAACGGAACCGCACGAGGGCAAACGCATTACGGAATCC
CTTTGGCCCATTTTCAAGATCCACCACCAGAAGACACGATACATCTACGA
TCTATTCTATCGCCGGAAAGCCATCAGCCGGGAATTGTACGACTACTGTC
TGAAGGAGAAGATTGCCGATGGCAATCTGATTGCCAAGTGGAAGAAGTCT
GGATACGAGAACCTATGCTGCCTGCGCTGCATTCAAACGAGGGACACCAA
TTTCGGCACGAACTGCATATGCCGGGTGCCCAAATGCAAACTGGAAGAGG
GTCGGATCGTTGAGTGTGTCCACTGCGGTTGTCGCGGCTGCTCCGGTTAG
ATTCCATGTGGACGCATTATTGGCATCTTTATTCGACACAAATAATCCTC
ATAATACATAGTTCAGTAGGTTCAACTTTAGATTTCGCCTGATTTCTTCA
TAGTATGTAAATACATTTAAATACAAGCCACAATTATGGTTAATGGCATG
CTAAACATCTAAATAGATGCTGCAATAAACCGATTATGTAAACGACAAGG
CATCGTTGGGAAATGCGTTCCGATTTGTTTAAAAAAAAATGTAGAAATGG
TATGAGCAGACATTTTTGTATTAGAATGTATAGAAAAGATAGAAATTAAC
TTGTAGTTTAATCAAATAAATAGAGATTATAATTTATGAAAAAAAAAAAA
AAAA

RE22390.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:54:47
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)10Bb-RA 1012 l(1)10Bb-RA 50..940 2..892 4440 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:00:30
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 11215489..11216169 888..208 3330 99.3 Minus
chrX 22417052 chrX 11216249..11216458 209..2 985 99 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:00:28
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 11324328..11325012 892..208 3410 99.9 Minus
X 23542271 X 11325092..11325299 209..2 1040 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:27:15
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 11332426..11333110 892..208 3410 99.8 Minus
X 23527363 X 11333190..11333397 209..2 1040 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:00:29 has no hits.

RE22390.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:01:07 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 11216249..11216458 1..209 98   Minus
chrX 11215514..11216167 210..863 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:27 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..435 116..550 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:32:37 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..435 116..550 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:47:29 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..435 116..550 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:23:09 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..435 116..550 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:33:58 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..435 116..550 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:03:07 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..887 2..888 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:32:37 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..887 2..888 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:47:29 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 9..896 1..888 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:23:11 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 1..887 2..888 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:33:58 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)10Bb-RA 9..896 1..888 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:07 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
X 11324332..11325010 210..888 99 <- Minus
X 11325092..11325299 1..209 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:07 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
X 11324332..11325010 210..888 99 <- Minus
X 11325092..11325299 1..209 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:07 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
X 11324332..11325010 210..888 99 <- Minus
X 11325092..11325299 1..209 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:47:29 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 11218365..11219043 210..888 99 <- Minus
arm_X 11219125..11219332 1..209 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:56:37 Download gff for RE22390.complete
Subject Subject Range Query Range Percent Splice Strand
X 11332430..11333108 210..888 99 <- Minus
X 11333190..11333397 1..209 99   Minus

RE22390.pep Sequence

Translation from 115 to 549

> RE22390.pep
MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIF
KIHHQKTRYIYDLFYRRKAISRELYDYCLKEKIADGNLIAKWKKSGYENL
CCLRCIQTRDTNFGTNCICRVPKCKLEEGRIVECVHCGCRGCSG*

RE22390.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 08:14:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22353-PA 433 GF22353-PA 1..144 1..144 777 98.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 08:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18863-PA 144 GG18863-PA 1..144 1..144 753 99.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 08:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12222-PA 144 GH12222-PA 1..144 1..144 746 97.2 Plus
Dgri\GH22904-PA 144 GH22904-PA 1..144 1..144 744 97.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:24:08
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)10Bb-PA 144 CG1639-PA 1..144 1..144 808 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 08:14:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18389-PA 144 GI18389-PA 1..144 1..144 745 97.9 Plus
Dmoj\GI15753-PA 144 GI15753-PA 1..144 1..144 745 98.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 08:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13722-PA 144 GL13722-PA 1..144 1..144 740 96.5 Plus
Dper\GL20292-PA 63 GL20292-PA 13..63 32..91 197 68.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 08:14:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27004-PA 144 GA27004-PA 1..144 1..144 740 96.5 Plus
Dpse\GA28695-PA 53 GA28695-PA 3..53 12..71 188 66.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 08:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11248-PA 144 GM11248-PA 1..144 1..144 758 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 08:14:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15995-PA 144 GD15995-PA 1..144 1..144 758 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 08:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21466-PA 144 GJ21466-PA 1..144 1..144 753 99.3 Plus
Dvir\GJ18612-PA 144 GJ18612-PA 1..144 1..144 744 97.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 08:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16514-PA 144 GK16514-PA 1..144 1..144 748 98.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 08:14:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17304-PA 144 GE17304-PA 1..144 1..144 753 99.3 Plus

RE22390.hyp Sequence

Translation from 115 to 549

> RE22390.hyp
MPKVRRSRKPPPDGWELIEPTLEELEQKMREAETEPHEGKRITESLWPIF
KIHHQKTRYIYDLFYRRKAISRELYDYCLKEKIADGNLIAKWKKSGYENL
CCLRCIQTRDTNFGTNCICRVPKCKLEEGRIVECVHCGCRGCSG*

RE22390.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:59:44
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)10Bb-PA 144 CG1639-PA 1..144 1..144 808 100 Plus