Clone RE22403 Report

Search the DGRC for RE22403

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:224
Well:3
Vector:pFlc-1
Associated Gene/TranscriptCG12859-RA
Protein status:RE22403.pep: gold
Sequenced Size:488

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12859 2003-01-01 Sim4 clustering to Release 3
CG12859 2004-05-05 Blastp of sequenced clone
CG12859 2008-04-29 Release 5.5 accounting
CG12859 2008-08-15 Release 5.9 accounting
CG12859 2008-12-18 5.12 accounting

Clone Sequence Records

RE22403.complete Sequence

488 bp (488 high quality bases) assembled on 2004-05-05

GenBank Submission: BT014650

> RE22403.complete
TCTGTATACGTTCACACCTGCCAGCTGTTGCTAAAAATTTGGTTTGCAAC
ACAAAACAAGAAAAATGGTTTTGTCCAACGAGGAGCAGGAGTTCATTAAG
CGCAAGCACGAGGCGACGCTGAAGCTGCGCCAGGAGTTCCTCAAGCAGAG
CTCCAATCCCTACCGCCATGCCACCGGCGAGGGCGGCACCGTTTTCGATG
CGGGATTAGCCCGTTTCCAGGCGATGCGAGTCTCCAACTACGAACACTTC
AAGCCCACCGGCAAATCCTTCCGCACGGGCCTTTTCGCCGTCGTCCTGCC
GATTGCCCTCTACGCCTGGGCTTTGAAGGCGGAGCGCGATGGACGCGAGG
AGAAGTACAGGACTGGCCAGGTGGCCTACAAGGACCGCCAGTTCAAGTTC
ATCTAAGCCATACATTCAGCCAATTGATCTTCGATTCGTATAGTGGAATT
AAAACAAAACCGTAATGAAGCTAAAAAAAAAAAAAAAA

RE22403.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:51:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-RA 597 CG12859-RA 67..539 1..473 2365 100 Plus
CG10153-RA 743 CG10153-RA 704..743 473..434 200 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:01:14
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 10644080..10644358 194..472 1395 100 Plus
chr2R 21145070 chr2R 10643807..10643999 1..193 965 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:18 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:01:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 14756794..14757073 194..473 1400 100 Plus
2R 25286936 2R 14756521..14756713 1..193 965 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:11:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 14757993..14758272 194..473 1400 100 Plus
2R 25260384 2R 14757720..14757912 1..193 965 100 Plus
Blast to na_te.dros performed on 2019-03-16 12:01:13 has no hits.

RE22403.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:02:26 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 10643807..10643999 1..193 100 -> Plus
chr2R 10644080..10644358 194..472 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:28 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 65..406 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:47:57 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 65..406 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:48:06 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 65..406 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:29:04 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 65..406 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:34:04 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..342 65..406 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:57:36 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..472 1..472 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:47:57 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..472 1..472 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:48:06 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 6..477 1..472 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:29:04 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 1..472 1..472 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:34:04 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
CG12859-RA 6..477 1..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:26 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14756521..14756713 1..193 100 -> Plus
2R 14756794..14757072 194..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:26 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14756521..14756713 1..193 100 -> Plus
2R 14756794..14757072 194..472 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:02:26 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14756521..14756713 1..193 100 -> Plus
2R 14756794..14757072 194..472 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:48:06 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 10644026..10644218 1..193 100 -> Plus
arm_2R 10644299..10644577 194..472 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:06:07 Download gff for RE22403.complete
Subject Subject Range Query Range Percent Splice Strand
2R 14757993..14758271 194..472 100   Plus
2R 14757720..14757912 1..193 100 -> Plus

RE22403.pep Sequence

Translation from 64 to 405

> RE22403.pep
MVLSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLAR
FQAMRVSNYEHFKPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRT
GQVAYKDRQFKFI*

RE22403.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:46:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11341-PA 113 GF11341-PA 1..113 1..113 553 91.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20479-PA 113 GG20479-PA 1..113 1..113 584 97.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20754-PA 113 GH20754-PA 1..113 1..113 523 84.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:15
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B15-PA 113 CG12859-PA 1..113 1..113 585 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:46:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI20839-PA 113 GI20839-PA 1..113 1..113 508 81.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL11460-PA 113 GL11460-PA 1..113 1..113 551 90.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:46:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA11862-PA 113 GA11862-PA 1..113 1..113 551 90.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21569-PA 113 GM21569-PA 1..113 1..113 588 98.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD11075-PA 86 GD11075-PA 1..80 1..80 415 97.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:46:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ20574-PA 113 GJ20574-PA 1..113 1..113 529 86.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK19634-PA 113 GK19634-PA 1..113 1..113 548 90.3 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:46:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13609-PA 113 GE13609-PA 1..113 1..113 586 98.2 Plus

RE22403.hyp Sequence

Translation from 64 to 405

> RE22403.hyp
MVLSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLAR
FQAMRVSNYEHFKPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRT
GQVAYKDRQFKFI*

RE22403.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:37:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG12859-PA 113 CG12859-PA 1..113 1..113 585 100 Plus