BDGP Sequence Production Resources |
Search the DGRC for RE22403
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 224 |
Well: | 3 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG12859-RA |
Protein status: | RE22403.pep: gold |
Sequenced Size: | 488 |
Gene | Date | Evidence |
---|---|---|
CG12859 | 2003-01-01 | Sim4 clustering to Release 3 |
CG12859 | 2004-05-05 | Blastp of sequenced clone |
CG12859 | 2008-04-29 | Release 5.5 accounting |
CG12859 | 2008-08-15 | Release 5.9 accounting |
CG12859 | 2008-12-18 | 5.12 accounting |
488 bp (488 high quality bases) assembled on 2004-05-05
GenBank Submission: BT014650
> RE22403.complete TCTGTATACGTTCACACCTGCCAGCTGTTGCTAAAAATTTGGTTTGCAAC ACAAAACAAGAAAAATGGTTTTGTCCAACGAGGAGCAGGAGTTCATTAAG CGCAAGCACGAGGCGACGCTGAAGCTGCGCCAGGAGTTCCTCAAGCAGAG CTCCAATCCCTACCGCCATGCCACCGGCGAGGGCGGCACCGTTTTCGATG CGGGATTAGCCCGTTTCCAGGCGATGCGAGTCTCCAACTACGAACACTTC AAGCCCACCGGCAAATCCTTCCGCACGGGCCTTTTCGCCGTCGTCCTGCC GATTGCCCTCTACGCCTGGGCTTTGAAGGCGGAGCGCGATGGACGCGAGG AGAAGTACAGGACTGGCCAGGTGGCCTACAAGGACCGCCAGTTCAAGTTC ATCTAAGCCATACATTCAGCCAATTGATCTTCGATTCGTATAGTGGAATT AAAACAAAACCGTAATGAAGCTAAAAAAAAAAAAAAAA
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 10643807..10643999 | 1..193 | 100 | -> | Plus |
chr2R | 10644080..10644358 | 194..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..342 | 65..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..342 | 65..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..342 | 65..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..342 | 65..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..342 | 65..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..472 | 1..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..472 | 1..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 6..477 | 1..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 1..472 | 1..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG12859-RA | 6..477 | 1..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14756521..14756713 | 1..193 | 100 | -> | Plus |
2R | 14756794..14757072 | 194..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14756521..14756713 | 1..193 | 100 | -> | Plus |
2R | 14756794..14757072 | 194..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14756521..14756713 | 1..193 | 100 | -> | Plus |
2R | 14756794..14757072 | 194..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 10644026..10644218 | 1..193 | 100 | -> | Plus |
arm_2R | 10644299..10644577 | 194..472 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 14757993..14758271 | 194..472 | 100 | Plus | |
2R | 14757720..14757912 | 1..193 | 100 | -> | Plus |
Translation from 64 to 405
> RE22403.pep MVLSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLAR FQAMRVSNYEHFKPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRT GQVAYKDRQFKFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF11341-PA | 113 | GF11341-PA | 1..113 | 1..113 | 553 | 91.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG20479-PA | 113 | GG20479-PA | 1..113 | 1..113 | 584 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH20754-PA | 113 | GH20754-PA | 1..113 | 1..113 | 523 | 84.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ND-B15-PA | 113 | CG12859-PA | 1..113 | 1..113 | 585 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI20839-PA | 113 | GI20839-PA | 1..113 | 1..113 | 508 | 81.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL11460-PA | 113 | GL11460-PA | 1..113 | 1..113 | 551 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA11862-PA | 113 | GA11862-PA | 1..113 | 1..113 | 551 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM21569-PA | 113 | GM21569-PA | 1..113 | 1..113 | 588 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD11075-PA | 86 | GD11075-PA | 1..80 | 1..80 | 415 | 97.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ20574-PA | 113 | GJ20574-PA | 1..113 | 1..113 | 529 | 86.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK19634-PA | 113 | GK19634-PA | 1..113 | 1..113 | 548 | 90.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE13609-PA | 113 | GE13609-PA | 1..113 | 1..113 | 586 | 98.2 | Plus |
Translation from 64 to 405
> RE22403.hyp MVLSNEEQEFIKRKHEATLKLRQEFLKQSSNPYRHATGEGGTVFDAGLAR FQAMRVSNYEHFKPTGKSFRTGLFAVVLPIALYAWALKAERDGREEKYRT GQVAYKDRQFKFI*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG12859-PA | 113 | CG12859-PA | 1..113 | 1..113 | 585 | 100 | Plus |