Clone RE22677 Report

Search the DGRC for RE22677

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:226
Well:77
Vector:pFlc-1
Associated Gene/TranscriptCG9577-RA
Protein status:RE22677.pep: gold
Preliminary Size:1012
Sequenced Size:1145

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9577 2001-12-14 Blastp of sequenced clone
CG9577 2002-01-01 Sim4 clustering to Release 2
CG9577 2003-01-01 Sim4 clustering to Release 3
CG9577 2008-04-29 Release 5.5 accounting
CG9577 2008-08-15 Release 5.9 accounting
CG9577 2008-12-18 5.12 accounting

Clone Sequence Records

RE22677.complete Sequence

1145 bp (1145 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071173

> RE22677.complete
AGCTCTGCTACGTATCGTTAAGCAAACAAAACAAATTTAGCTGCCGCAAC
AAGTAGATTTGATTTGAAACCAGTGAAAAGAAGGTTTATTATGTCGCTCT
CCCGCCTGAACACTCTGATGAAACTAACGCCCAAGCCCACGGCCATCGGA
TCCCTTAAGATGCAGAGAAACCTTTCCGCCCTCCCGGAATCCGGACCCAC
CGGCTCTTTCAAGACGCTGGCCGTCAGTTCGCCCAAGCCGTTCGTCTTTC
ATGTGGAGCTCCATCGGCCCAGCAAGTTCAACGCCATAAGCAAGCAGATG
TGGCTGGAGATCAAGGAGTGCTTCGACGGACTGGCCACTAATCCCGACTG
CCGGGCTATCGTTTTGTCCGCCTCCGGAAAGCACTTCACCGCCGGCATCG
ACCTCAACGACATGATAAACGTGGGCCAAACGCTGGCCGAGACCGATGAC
TACGCCCGCAAGGGCGTCTCCATGGAGCGAATGATCAAGGTGTACCAGGA
CTCAATCAGCAGCCTGGAGCACTGCCCCAAGCCGGTCATCACGGCGGTGC
ACAAGGCGTGCATCGGCGCCGGCGTGGACCTGATTACCGCCGCCGACATT
CGCTACTGCACCGAGGACGCCTTTTTCCAGGTCAAGGAGGTGGACATCGG
CATGGCCGCCGACGTGGGCACCCTGCAGCGTCTGCCCAAGGCAGTGGGCA
GTCAGTCCCTCGCCCGCGAGCTGTGCTTCACTGGGCGCAAATTCGAGGCC
GCCGAGGCCCACTCCTCGGGCCTGGTGAGTCGCCTCTTCCCAGACAAGGA
TTCCCTGCTGACCGGAGCCCTGGCCGTGGCCGAGCTCATCGCTAGCAAGA
GTCCCGTCGCCGTAAAGACAACCAAGGAGAGCCTCGTGTACTCCCTGGAG
CACACCAATCAAGAGGGCTTGGATCACATTCTCCTGCTGAACAAGCTCAA
CCTGCTGTCGGAGGACTTCGCCCAGGCTGTGGCCGCCCAGTTGACGAAGG
ACGATAAGCCAGTGTTCGCCAAGCTGTGATCGGTAACCTGTAATATGTAA
TCTGCAATCTGACAGAATTTAAAATGTATTTGCCATGTGTGCATTTATAA
ATACAGCATCTGCCTTTACTTTAGGACCCAAAAAAAAAAAAAAAA

RE22677.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG9577-RA 1357 CG9577-RA 182..1313 1..1132 5645 99.9 Plus
CG9581.a 1848 CG9581.a 1807..1848 1132..1091 210 100 Minus
CG9581-RA 1895 CG9581-RA 1854..1895 1132..1091 210 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:21:24
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 20055739..20056363 306..930 3125 100 Plus
chrX 22417052 chrX 20056430..20056628 931..1129 995 100 Plus
chrX 22417052 chrX 20055504..20055668 142..306 825 100 Plus
chrX 22417052 chrX 20055223..20055364 1..142 695 99.3 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:21:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 20167191..20167815 306..930 3125 100 Plus
X 23542271 X 20167882..20168083 931..1132 1010 100 Plus
X 23542271 X 20166956..20167120 142..306 825 100 Plus
X 23542271 X 20166675..20166816 1..142 695 99.3 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:10:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 20175289..20175913 306..930 3125 100 Plus
X 23527363 X 20175980..20176181 931..1132 1010 100 Plus
X 23527363 X 20175054..20175218 142..306 825 100 Plus
X 23527363 X 20174773..20174914 1..142 695 99.2 Plus
Blast to na_te.dros performed on 2019-03-15 16:21:23 has no hits.

RE22677.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:22:45 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 20055223..20055364 1..142 99 -> Plus
chrX 20055505..20055667 143..305 100 -> Plus
chrX 20055739..20056363 306..930 100 -> Plus
chrX 20056430..20056628 931..1129 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:39 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..939 91..1029 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:35 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..939 91..1029 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:00:42 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..939 91..1029 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:34:46 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..939 91..1029 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:33:59 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..939 91..1029 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:30 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..1129 1..1129 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:34 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..1129 1..1129 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:00:42 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 3..1131 1..1129 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:34:46 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 1..1129 1..1129 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:33:59 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
CG9577-RA 3..1131 1..1129 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:45 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
X 20166675..20166816 1..142 99 -> Plus
X 20166957..20167119 143..305 100 -> Plus
X 20167191..20167815 306..930 100 -> Plus
X 20167882..20168080 931..1129 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:45 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
X 20166675..20166816 1..142 99 -> Plus
X 20166957..20167119 143..305 100 -> Plus
X 20167191..20167815 306..930 100 -> Plus
X 20167882..20168080 931..1129 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:45 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
X 20166675..20166816 1..142 99 -> Plus
X 20166957..20167119 143..305 100 -> Plus
X 20167191..20167815 306..930 100 -> Plus
X 20167882..20168080 931..1129 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:00:42 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 20060708..20060849 1..142 99 -> Plus
arm_X 20060990..20061152 143..305 100 -> Plus
arm_X 20061224..20061848 306..930 100 -> Plus
arm_X 20061915..20062113 931..1129 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:00 Download gff for RE22677.complete
Subject Subject Range Query Range Percent Splice Strand
X 20175289..20175913 306..930 100 -> Plus
X 20175980..20176178 931..1129 100   Plus
X 20174773..20174914 1..142 99 -> Plus
X 20175055..20175217 143..305 100 -> Plus

RE22677.hyp Sequence

Translation from 90 to 1028

> RE22677.hyp
MSLSRLNTLMKLTPKPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKP
FVFHVELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFT
AGIDLNDMINVGQTLAETDDYARKGVSMERMIKVYQDSISSLEHCPKPVI
TAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAADVGTLQRLPK
AVGSQSLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLLTGALAVAELI
ASKSPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLLSEDFAQAVAAQ
LTKDDKPVFAKL*

RE22677.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
CG9577-PA 312 CG9577-PA 1..312 1..312 1574 100 Plus
CG6543-PA 295 CG6543-PA 55..261 55..277 240 31.4 Plus
CG6543-PB 295 CG6543-PB 55..261 55..277 240 31.4 Plus
CG8778-PA 299 CG8778-PA 3..250 1..262 222 28.3 Plus
CG13890-PA 262 CG13890-PA 21..187 56..233 152 24.2 Plus

RE22677.pep Sequence

Translation from 90 to 1028

> RE22677.pep
MSLSRLNTLMKLTPKPTAIGSLKMQRNLSALPESGPTGSFKTLAVSSPKP
FVFHVELHRPSKFNAISKQMWLEIKECFDGLATNPDCRAIVLSASGKHFT
AGIDLNDMINVGQTLAETDDYARKGVSMERMIKVYQDSISSLEHCPKPVI
TAVHKACIGAGVDLITAADIRYCTEDAFFQVKEVDIGMAADVGTLQRLPK
AVGSQSLARELCFTGRKFEAAEAHSSGLVSRLFPDKDSLLTGALAVAELI
ASKSPVAVKTTKESLVYSLEHTNQEGLDHILLLNKLNLLSEDFAQAVAAQ
LTKDDKPVFAKL*

RE22677.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20237-PA 318 GF20237-PA 1..318 1..312 1334 79.9 Plus
Dana\GF11161-PA 293 GF11161-PA 53..261 55..279 244 30.7 Plus
Dana\GF11465-PA 299 GF11465-PA 42..250 45..262 227 29.8 Plus
Dana\GF24414-PA 260 GF24414-PA 20..238 55..281 168 24.3 Plus
Dana\GF11437-PA 280 GF11437-PA 6..232 21..263 158 24.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:11:57
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19273-PA 314 GG19273-PA 1..314 1..312 1506 93.9 Plus
Dere\GG22466-PA 294 GG22466-PA 44..260 45..277 245 30.5 Plus
Dere\GG22562-PA 299 GG22562-PA 42..250 45..262 235 31.1 Plus
Dere\GG14742-PA 262 GG14742-PA 21..238 56..281 149 23.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:11:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH12615-PA 294 GH12615-PA 14..294 32..312 1164 77.9 Plus
Dgri\GH20865-PA 293 GH20865-PA 43..259 45..277 266 31.3 Plus
Dgri\GH22640-PA 298 GH22640-PA 53..249 57..262 212 30 Plus
Dgri\GH11876-PA 272 GH11876-PA 12..225 39..253 158 25.9 Plus
Dgri\GH16867-PA 259 GH16867-PA 19..186 55..233 156 24.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:43:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG9577-PA 312 CG9577-PA 1..312 1..312 1574 100 Plus
Echs1-PA 295 CG6543-PA 55..261 55..277 240 31.4 Plus
Echs1-PB 295 CG6543-PB 55..261 55..277 240 31.4 Plus
CG8778-PA 299 CG8778-PA 3..250 1..262 222 28.3 Plus
Dci-PA 262 CG13890-PA 21..187 56..233 152 24.2 Plus
CG5844-PA 378 CG5844-PA 60..260 55..268 152 27 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11030-PA 310 GI11030-PA 1..310 1..312 1220 72.1 Plus
Dmoj\GI20973-PA 293 GI20973-PA 43..259 45..277 264 31.3 Plus
Dmoj\GI21154-PA 301 GI21154-PA 56..252 57..262 214 31.4 Plus
Dmoj\GI15664-PA 275 GI15664-PA 12..210 36..237 168 25.4 Plus
Dmoj\GI11426-PA 260 GI11426-PA 6..187 40..233 167 23.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:11:59
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13079-PA 319 GL13079-PA 1..319 1..312 1296 76.2 Plus
Dper\GL16995-PA 296 GL16995-PA 90..262 89..277 229 36 Plus
Dper\GL11030-PA 191 GL11030-PA 19..142 141..262 169 35.2 Plus
Dper\GL16867-PA 261 GL16867-PA 21..188 55..233 156 26.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA21887-PA 319 GA21887-PA 1..319 1..312 1296 76.2 Plus
Dpse\GA19673-PB 296 GA19673-PB 35..262 34..277 271 33.2 Plus
Dpse\GA19673-PA 296 GA19673-PA 35..262 34..277 271 33.2 Plus
Dpse\GA21314-PA 298 GA21314-PA 53..249 57..262 205 30.5 Plus
Dpse\GA12604-PA 260 GA12604-PA 20..191 55..237 189 27.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:12:00
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM23012-PA 312 GM23012-PA 1..312 1..312 1617 97.1 Plus
Dsec\GM20252-PA 294 GM20252-PA 54..260 55..277 247 31.4 Plus
Dsec\GM20345-PA 233 GM20345-PA 19..184 88..262 200 34.1 Plus
Dsec\GM14360-PA 262 GM14360-PA 21..187 56..233 147 24.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25738-PA 294 GD25738-PA 54..260 55..277 247 31.4 Plus
Dsim\GD25824-PA 299 GD25824-PA 3..250 1..262 240 29 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:12:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15810-PA 313 GJ15810-PA 1..313 1..312 1221 72.5 Plus
Dvir\GJ20693-PA 293 GJ20693-PA 43..259 45..277 267 31.8 Plus
Dvir\GJ21004-PA 281 GJ21004-PA 36..232 57..262 208 31.4 Plus
Dvir\GJ19197-PA 274 GJ19197-PA 17..246 39..278 160 24.6 Plus
Dvir\GJ13621-PA 260 GJ13621-PA 2..187 36..233 159 22.7 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25337-PA 317 GK25337-PA 1..317 1..312 1206 69.4 Plus
Dwil\GK17937-PA 295 GK17937-PA 45..261 45..277 246 30.5 Plus
Dwil\GK15915-PA 302 GK15915-PA 57..253 57..262 221 31.9 Plus
Dwil\GK17361-PA 262 GK17361-PA 17..189 52..233 211 26.9 Plus
Dwil\GK14405-PA 390 GK14405-PA 49..262 41..268 163 26.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:12:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15891-PA 314 GE15891-PA 1..314 1..312 1523 94.6 Plus
Dyak\GE13337-PA 294 GE13337-PA 54..260 55..277 248 31.4 Plus
Dyak\GE13432-PA 299 GE13432-PA 23..250 26..262 238 30.3 Plus
Dyak\GE21104-PA 262 GE21104-PA 21..238 56..281 155 23.6 Plus