Clone RE22765 Report

Search the DGRC for RE22765

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:227
Well:65
Vector:pFlc-1
Associated Gene/Transcriptdgrn-RB
Protein status:RE22765.pep: gold
Preliminary Size:1642
Sequenced Size:1450

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10981 2002-10-01 Blastp of sequenced clone
CG10981 2003-01-01 Sim4 clustering to Release 3
CG10981 2008-04-29 Release 5.5 accounting
CG10981 2008-08-15 Release 5.9 accounting
CG10981 2008-12-18 5.12 accounting

Clone Sequence Records

RE22765.complete Sequence

1450 bp (1450 high quality bases) assembled on 2002-10-01

GenBank Submission: BT001574

> RE22765.complete
ATCTTTAAAATAACCGAATGGTCGCGTGAAAGGAGGAAACTATTTTGCAC
ATTTCAATCTGCACTAAAGCACATGTATATCTGGGTTCACCTGCTTTTGT
CTTTACTACGAAATCATTTCACAAGTTTCCTGGTCATTTGTTGCTCGAAC
AATGTCAGATTCGACTATTTTCCGTTTTTCAGCGGACAGCAACGTATCCA
GTTCGAGCTCCAATTCCAGTGTATCCGACTCTTCTGTGGACTCCCATTCA
TCCATAGAATCCAATTCGGGACACAATACATCCGTGGAATCTCAGTCATC
CGCGGAATCTGATTCATCCGCTGATTCCCATTCGTCCTTGGAACGCCCAT
CCCCAGTGGAGCGTGATTTATCTGTGGAATCAGACTCATCTTCAGCCACC
AATACCAGCGAATCTTCAGTCGGAGAAGCTTCAAACCAACTGCAGTCACC
GCAAAGCAATAACCCCTTAAATATGGCTAACTTGTCTGTCTCGACTGAAG
ATGCTCATTCGCAGATCAGATCACTTACCCAGGATGTGATCCAGATGGAA
GCAGAGTTGGATCGCATGAATCGCTACTGCGAGGAAGTTGTGGCACAGAT
TGACACCTTCGCCACGAGAACCTCAACGCCAACAACTCGTAGAATTCGCC
GCAGAACGAGTCCAGTAGAAGTGATAGATCTGTCCCATTTGGACCGTGCA
CCACCTGTTCGATCCGCTCGGAATCGTGATCCCGATGCTTTCATCGATCT
ATGCACCCCCGAAGGCCCAAGAAGTCGCACAGTGAATCTTCACTCCAACG
ACTCCCTCACCATTCTGCCACGTCGGTCAGCCGAAAATGACCCGGTAGTG
GATCTCGACGTTGCGTCGCCACCAAAACGCGTTAATCGCGACATTGATGA
GTCCCAAAAAGAGGAGTTATACAAGTGCCCCATCTGCATGGACAGTGTAT
CGAAGCGCGAGCCAGTGTCAACCAAATGTGGACACGTCTTCTGCCGCGAA
TGCATCGAAACAGCCATCAGAGCTACGCACAAGTGCCCAATATGCAACAA
GAAGCTGACCGCACGTCAATTCTTTCGCATTTACTTGTAAGTTGCTTATA
CTATTTCACATTTTTTGCTCTGTGAGCCTTAATATAATATAGTTTAAAAA
AAAACGCTTAACTATGTTAGAGACGGCAAATAATGTCTGTTCTTGTGATT
CAGAAAAAATTAGTTATTTAAGTTGTCCTATGTAATCAGTGGCGCCCAAA
AATATTTGAATACAACTATAAAAACTAAAGACTTCACTTTTGATGTATGA
AACCATCTCAGGCTAGAATAATATAAGAACGACCGAAAGGAGTGTCAAAG
TATTATGTAGGCATTTTTCCAAACGCAATTTAACAATGTAACATACATAT
AATATAATAAATAAAATGGTCCCAACGCATATCGAAAAAAAAAAAAAAAA

RE22765.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:40:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG10981-RB 1630 CG10981-RB 194..1626 1..1433 7165 100 Plus
CG10981-RA 1657 CG10981-RA 399..1653 179..1433 6275 100 Plus
CG10981-RA 1657 CG10981-RA 200..377 1..178 890 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 07:33:50
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 1651451..1652227 657..1433 3885 100 Plus
chr3R 27901430 chr3R 1650703..1651090 179..566 1940 100 Plus
chr3R 27901430 chr3R 1650444..1650621 1..178 890 100 Plus
chr3R 27901430 chr3R 1651145..1651234 567..656 450 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 07:33:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 5825805..5826581 657..1433 3885 100 Plus
3R 32079331 3R 5825057..5825444 179..566 1940 100 Plus
3R 32079331 3R 5824798..5824975 1..178 890 100 Plus
3R 32079331 3R 5825499..5825588 567..656 450 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:14:04
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 5566636..5567412 657..1433 3885 100 Plus
3R 31820162 3R 5565888..5566275 179..566 1940 100 Plus
3R 31820162 3R 5565629..5565806 1..178 890 100 Plus
3R 31820162 3R 5566330..5566419 567..656 450 100 Plus
Blast to na_te.dros performed on 2019-03-16 07:33:48 has no hits.

RE22765.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 07:34:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 1650444..1650621 1..178 100 -> Plus
chr3R 1650703..1651090 179..566 100 -> Plus
chr3R 1651145..1651234 567..656 100 -> Plus
chr3R 1651451..1652227 657..1434 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:46 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 1..939 152..1090 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:13:03 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 1..939 152..1090 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 08:23:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RB 1..939 152..1090 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:04:08 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 1..939 152..1090 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 06:35:52 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RB 1..939 152..1090 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:35:33 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 194..1621 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:13:03 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 194..1621 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 08:23:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RB 194..1621 1..1428 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:04:09 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
CG10981-RB 194..1621 1..1428 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 06:35:52 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
dgrn-RB 184..1611 1..1428 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824798..5824975 1..178 100 -> Plus
3R 5825057..5825444 179..566 100 -> Plus
3R 5825499..5825588 567..656 100 -> Plus
3R 5825805..5826581 657..1434 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824798..5824975 1..178 100 -> Plus
3R 5825057..5825444 179..566 100 -> Plus
3R 5825499..5825588 567..656 100 -> Plus
3R 5825805..5826581 657..1434 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 07:34:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5824798..5824975 1..178 100 -> Plus
3R 5825057..5825444 179..566 100 -> Plus
3R 5825499..5825588 567..656 100 -> Plus
3R 5825805..5826581 657..1434 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 08:23:45 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 1650520..1650697 1..178 100 -> Plus
arm_3R 1650779..1651166 179..566 100 -> Plus
arm_3R 1651221..1651310 567..656 100 -> Plus
arm_3R 1651527..1652303 657..1434 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:35:48 Download gff for RE22765.complete
Subject Subject Range Query Range Percent Splice Strand
3R 5565888..5566275 179..566 100 -> Plus
3R 5566330..5566419 567..656 100 -> Plus
3R 5566636..5567412 657..1434 99   Plus
3R 5565629..5565806 1..178 100 -> Plus

RE22765.pep Sequence

Translation from 151 to 1089

> RE22765.pep
MSDSTIFRFSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNTSVESQSS
AESDSSADSHSSLERPSPVERDLSVESDSSSATNTSESSVGEASNQLQSP
QSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYCEEVVAQI
DTFATRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRDPDAFIDL
CTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKRVNRDIDE
SQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNK
KLTARQFFRIYL*

RE22765.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 03:29:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16357-PA 202 GF16357-PA 16..202 124..312 588 60.5 Plus
Dana\GF14677-PA 326 GF14677-PA 157..326 136..312 357 45.1 Plus
Dana\GF15935-PA 116 GF15935-PA 31..116 232..312 209 45.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 03:29:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG13065-PA 320 GG13065-PA 51..320 63..312 920 71.1 Plus
Dere\GG22477-PA 94 GG22477-PA 22..94 238..312 198 50.7 Plus
Dere\GG21725-PA 192 GG21725-PA 114..192 227..312 180 43 Plus
Dere\GG23586-PA 106 GG23586-PA 54..105 256..311 163 50 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 03:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22295-PA 202 GH22295-PA 84..202 159..312 270 37.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:35:18
Subject Length Description Subject Range Query Range Score Percent Strand
dgrn-PB 312 CG10981-PB 1..312 1..312 1584 100 Plus
dgrn-PA 319 CG10981-PA 1..319 1..312 1566 97.8 Plus
dgrn-PD 205 CG10981-PD 1..205 108..312 1070 100 Plus
CG43058-PA 100 CG43058-PA 10..100 187..312 214 35.7 Plus
elfless-PC 229 CG15150-PC 42..229 149..312 183 30.7 Plus
elfless-PB 229 CG15150-PB 42..229 149..312 183 30.7 Plus
CG44271-PA 106 CG44271-PA 55..105 257..311 157 50.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 03:29:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21991-PA 294 GI21991-PA 68..294 116..312 384 43.2 Plus
Dmoj\GI14783-PA 374 GI14783-PA 319..374 257..312 222 62.5 Plus
Dmoj\GI13656-PA 254 GI13656-PA 199..254 257..312 218 58.9 Plus
Dmoj\GI15418-PA 707 GI15418-PA 651..707 257..312 182 50.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 03:29:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL24328-PA 317 GL24328-PA 102..317 112..312 428 48.2 Plus
Dper\GL24317-PA 151 GL24317-PA 27..151 191..312 218 42.5 Plus
Dper\GL20345-PA 117 GL20345-PA 43..117 236..312 216 53.2 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 03:29:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10686-PB 326 GA10686-PB 111..326 112..312 437 49.1 Plus
Dpse\GA26569-PA 209 GA26569-PA 85..209 191..312 251 43.6 Plus
Dpse\GA28705-PA 209 GA28705-PA 85..209 191..312 241 44.8 Plus
Dpse\GA28704-PA 209 GA28704-PA 85..209 191..312 241 44.8 Plus
Dpse\GA28682-PA 138 GA28682-PA 14..138 191..312 237 44.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 03:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10845-PA 329 GM10845-PA 1..329 1..312 1115 80.9 Plus
Dsec\GM20261-PA 167 GM20261-PA 21..87 235..298 171 47.1 Plus
Dsec\GM13869-PA 91 GM13869-PA 5..91 224..312 158 39.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 03:29:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19827-PA 329 GD19827-PA 42..329 35..312 1117 83 Plus
Dsim\GD25747-PA 101 GD25747-PA 15..101 229..312 207 45.5 Plus
Dsim\GD22545-PA 91 GD22545-PA 17..91 233..312 154 40 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 03:29:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18825-PA 288 GJ18825-PA 175..288 190..312 253 44.1 Plus
Dvir\GJ13990-PA 303 GJ13990-PA 246..303 255..312 224 58.6 Plus
Dvir\GJ16377-PA 273 GJ16377-PA 153..273 198..312 190 39.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 03:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK14441-PA 207 GK14441-PA 71..207 169..312 381 53.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 03:29:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE10170-PA 344 GE10170-PA 1..344 1..312 946 68.6 Plus
Dyak\GE13346-PA 230 GE13346-PA 146..230 230..312 214 44.7 Plus
Dyak\GE13114-PA 239 GE13114-PA 171..239 240..312 181 46.6 Plus
Dyak\GE18407-PA 107 GE18407-PA 55..106 256..311 147 44.6 Plus

RE22765.hyp Sequence

Translation from 151 to 1089

> RE22765.hyp
MSDSTIFRFSADSNVSSSSSNSSVSDSSVDSHSSIESNSGHNTSVESQSS
AESDSSADSHSSLERPSPVERDLSVESDSSSATNTSESSVGEASNQLQSP
QSNNPLNMANLSVSTEDAHSQIRSLTQDVIQMEAELDRMNRYCEEVVAQI
DTFATRTSTPTTRRIRRRTSPVEVIDLSHLDRAPPVRSARNRDPDAFIDL
CTPEGPRSRTVNLHSNDSLTILPRRSAENDPVVDLDVASPPKRVNRDIDE
SQKEELYKCPICMDSVSKREPVSTKCGHVFCRECIETAIRATHKCPICNK
KLTARQFFRIYL*

RE22765.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:30:34
Subject Length Description Subject Range Query Range Score Percent Strand
dgrn-PB 312 CG10981-PB 1..312 1..312 1584 100 Plus
dgrn-PA 319 CG10981-PA 1..319 1..312 1566 97.8 Plus
dgrn-PD 205 CG10981-PD 1..205 108..312 1070 100 Plus
CG43058-PA 100 CG43058-PA 10..100 187..312 214 35.7 Plus
elfless-PC 229 CG15150-PC 42..229 149..312 183 30.7 Plus