Clone RE22911 Report

Search the DGRC for RE22911

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:229
Well:11
Vector:pFlc-1
Associated Gene/TranscriptIbf2-RA
Protein status:RE22911.pep: gold
Preliminary Size:620
Sequenced Size:685

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9740 2001-12-14 Blastp of sequenced clone
CG9740 2002-01-01 Sim4 clustering to Release 2
CG9740 2003-01-01 Sim4 clustering to Release 3
CG9740 2008-04-29 Release 5.5 accounting
CG9740 2008-08-15 Release 5.9 accounting
CG9740 2008-12-18 5.12 accounting

Clone Sequence Records

RE22911.complete Sequence

685 bp (685 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071174

> RE22911.complete
AACACAAACCGTATGTAAAAATGTCGCAAGCAAAAAAGGCCAAGCGACCC
TCGGGCCTTTCGAAGGATGAAACTTGGAAGAAACTGGGCTTTCTACCCGC
GTTCAAGGGCGGCAAGGATGGGGAGCCGAAGAAGTACCGAGCGCTGTGCA
CCCACTGTCGGAAATGCCAATCAAACACCAGCATAGACAGGCTGATTATC
CATAGGAAGTCATGTCTCAAGTTCCGGGAGGATCTAACCGCTGAATTCGG
TATTAAGGTGGAGGCTACGGACGCCGCTCCGGCAGAACAGAGCTCTTCCG
GCTCCACAATTGACTTCACTTCGAATATTCTACTGGACAAACTGATCGAC
GAGGATGATAGCAGTGCACGCAATCAGGAATCCAACTTGGTGAGCTACTT
GACCGATCTGGATCAACTGGTGATCCCGTCATCCGACGCCAATCGACTGC
AGAAGGATCTGATCAAGGCGGAAACGGAGTATCTGGTGGTCAAATCCGAG
TACTTTACCAAGATGAACGAGATATCCGAACTGAAACGCACCGTCACCTT
GTTGGAGGCGAAAAAGACACAGCTGGAGATCGCCAAACTGCGTGCTGAAT
GCGAGTAGCCTAAGCTTTTTAAGTACACTACATTTTAAATTTCTTGAGAA
TATACAAATTTATTTAGACAAAAAAAAAAAAAAAA

RE22911.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG9740-RA 753 CG9740-RA 42..709 1..668 3340 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 5083503..5083967 668..204 2325 100 Minus
chr3R 27901430 chr3R 5084032..5084237 206..1 1030 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:28:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9257726..9258190 668..204 2325 100 Minus
3R 32079331 3R 9258255..9258460 206..1 1030 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:19
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 8998557..8999021 668..204 2325 100 Minus
3R 31820162 3R 8999086..8999291 206..1 1030 100 Minus
Blast to na_te.dros performed 2019-03-16 01:28:45
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3798..3847 668..618 108 70.6 Minus

RE22911.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:29:33 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 5083502..5083965 206..669 99 <- Minus
chr3R 5084033..5084237 1..205 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:02:52 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..588 21..608 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:25 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..588 21..608 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:07:10 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..588 21..608 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:56 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..588 21..608 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:34:51 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
Ibf2-RA 1..588 21..608 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:46 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..667 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:25 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 42..708 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:07:10 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 42..708 1..667 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:56 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
CG9740-RA 1..667 1..667 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:34:51 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
Ibf2-RA 42..708 1..667 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:33 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9257725..9258188 206..669 99 <- Minus
3R 9258256..9258460 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:33 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9257725..9258188 206..669 99 <- Minus
3R 9258256..9258460 1..205 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:29:33 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9257725..9258188 206..669 99 <- Minus
3R 9258256..9258460 1..205 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:07:10 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5083978..5084182 1..205 100   Minus
arm_3R 5083447..5083910 206..669 99 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:21 Download gff for RE22911.complete
Subject Subject Range Query Range Percent Splice Strand
3R 8998556..8999019 206..669 99 <- Minus
3R 8999087..8999291 1..205 100   Minus

RE22911.hyp Sequence

Translation from 2 to 607

> RE22911.hyp
HKPYVKMSQAKKAKRPSGLSKDETWKKLGFLPAFKGGKDGEPKKYRALCT
HCRKCQSNTSIDRLIIHRKSCLKFREDLTAEFGIKVEATDAAPAEQSSSG
STIDFTSNILLDKLIDEDDSSARNQESNLVSYLTDLDQLVIPSSDANRLQ
KDLIKAETEYLVVKSEYFTKMNEISELKRTVTLLEAKKTQLEIAKLRAEC
E*

RE22911.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:39
Subject Length Description Subject Range Query Range Score Percent Strand
Ibf2-PA 195 CG9740-PA 1..195 7..201 985 100 Plus

RE22911.pep Sequence

Translation from 20 to 607

> RE22911.pep
MSQAKKAKRPSGLSKDETWKKLGFLPAFKGGKDGEPKKYRALCTHCRKCQ
SNTSIDRLIIHRKSCLKFREDLTAEFGIKVEATDAAPAEQSSSGSTIDFT
SNILLDKLIDEDDSSARNQESNLVSYLTDLDQLVIPSSDANRLQKDLIKA
ETEYLVVKSEYFTKMNEISELKRTVTLLEAKKTQLEIAKLRAECE*

RE22911.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18423-PA 204 GF18423-PA 8..204 3..195 533 62 Plus
Dana\GF24686-PA 144 GF24686-PA 4..144 62..195 350 62.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:50:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17388-PA 195 GG17388-PA 1..195 1..195 952 92.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:21:48
Subject Length Description Subject Range Query Range Score Percent Strand
Ibf2-PA 195 CG9740-PA 1..195 1..195 985 100 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL13548-PA 184 GL13548-PA 2..184 6..195 512 57.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:50:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22000-PA 184 GA22000-PA 2..184 6..195 512 57.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM26276-PA 195 GM26276-PA 1..195 1..195 1005 97.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:50:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20811-PA 195 GD20811-PA 1..195 1..195 1013 99 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:50:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK22751-PA 195 GK22751-PA 15..195 18..195 405 45.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:50:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24792-PA 195 GE24792-PA 1..195 1..195 932 91.8 Plus