Clone RE23260 Report

Search the DGRC for RE23260

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:232
Well:60
Vector:pFlc-1
Associated Gene/TranscriptSrp9-RA
Protein status:RE23260.pep: gold
Preliminary Size:660
Sequenced Size:835

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG8268 2001-12-14 Blastp of sequenced clone
CG8268 2002-01-01 Sim4 clustering to Release 2
CG8268 2003-01-01 Sim4 clustering to Release 3
Srp9 2008-04-29 Release 5.5 accounting
Srp9 2008-08-15 Release 5.9 accounting
Srp9 2008-12-18 5.12 accounting

Clone Sequence Records

RE23260.complete Sequence

835 bp (835 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071180

> RE23260.complete
GTTGGTTTGGTATTTTTTCGATAGCTTCAACGTCACGCCGTCCAGTTGCT
GTTGTTGTTTTTAATAATTTCGCCTGGATTTCCATTTGTTTAAATAAAAA
ATGGTTTTTGTAAAGAACTGGGATGATTTCGAGATTGCCGTCGAGAACAT
GTACTTGGCCAATCCACAGAACTGTCGACTTACCATGAAATACGCGCACT
CCAAGGGCCACATTCTGCTAAAAATGACGGACAACGTTAAGTGTGTGCAG
TACAAAGCGGAGAACATGCCGGATCTCAGAAAAATCGAGAAGATCACCAG
CAACTTGGTGGGACACATGGCGTCCAAGGAATAGAACGCAGAAAAACAGA
AACTTTTTGGCCACGGCGACACTTCTGCCCAGGAACAACAACAAAGATCA
TAGCACATGCATGAGCATATGAATCGGCCACGAATGTTGTTGTTGCTTCG
CCGGAGCAGGTGTGTGCTTGTGTGTGTGCCATCAACACCCGCATTGAATT
TAGTTTTTAAGCACCAAAAAAGCCGCCGAGTTTTTGACATTCGAATGTGG
CGATCAGAGTAGCTGCTGCATTTAGCCTGCTTTTAAACGACATTTTATAA
ATGTCTGCTCTGTACACGTTGCGAATGAACTGCGGATGGAATCATCATCA
TCATTACTTCTCTTCTGGTGGTCCAAATCCCCATCTGCAGGCAGCGGCGG
CGGTGCAAAATGTTTTTCATAATGTTAACCATACGGTTTTGTATTTATCG
TAAGAGTCAATCGGTCTTTCAACACATTTCCATGAAACGATTAGCATGAA
ATAAATCAAGGGAGAACCGAAAAAAAAAAAAAAAA

RE23260.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:44:17
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-RA 1005 Srp9-RA 149..972 1..824 4105 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:27:33
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 7928808..7929385 240..817 2830 99.3 Plus
chr3L 24539361 chr3L 7928504..7928744 1..241 1190 99.6 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:42:59 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:27:31
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 7936679..7937263 240..824 2910 99.8 Plus
3L 28110227 3L 7936375..7936615 1..241 1205 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:11:00
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 7929779..7930363 240..824 2910 99.8 Plus
3L 28103327 3L 7929475..7929715 1..241 1205 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:27:32 has no hits.

RE23260.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:28:14 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 7928504..7928744 1..241 99 -> Plus
chr3L 7928810..7929387 242..819 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:07 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..234 101..334 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:10:51 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..234 101..334 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:40:52 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..234 101..334 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:35:03 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..234 101..334 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:32:36 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..234 101..334 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:40:53 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..819 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:10:51 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..819 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:40:52 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 3..821 1..819 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:35:03 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 1..819 1..819 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:32:36 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
Srp9-RA 3..821 1..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:14 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7936375..7936615 1..241 100 -> Plus
3L 7936681..7937258 242..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:14 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7936375..7936615 1..241 100 -> Plus
3L 7936681..7937258 242..819 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:14 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7936375..7936615 1..241 100 -> Plus
3L 7936681..7937258 242..819 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:40:52 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 7929475..7929715 1..241 100 -> Plus
arm_3L 7929781..7930358 242..819 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:12:18 Download gff for RE23260.complete
Subject Subject Range Query Range Percent Splice Strand
3L 7929475..7929715 1..241 100 -> Plus
3L 7929781..7930358 242..819 99   Plus

RE23260.hyp Sequence

Translation from 100 to 333

> RE23260.hyp
MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQ
YKAENMPDLRKIEKITSNLVGHMASKE*

RE23260.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-PA 77 CG8268-PA 1..77 1..77 409 100 Plus

RE23260.pep Sequence

Translation from 100 to 333

> RE23260.pep
MVFVKNWDDFEIAVENMYLANPQNCRLTMKYAHSKGHILLKMTDNVKCVQ
YKAENMPDLRKIEKITSNLVGHMASKE*

RE23260.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23801-PA 77 GF23801-PA 1..77 1..77 388 92.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:13:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14456-PA 77 GG14456-PA 1..77 1..77 390 93.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14982-PA 77 GH14982-PA 1..77 1..77 384 90.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:23:16
Subject Length Description Subject Range Query Range Score Percent Strand
Srp9-PA 77 CG8268-PA 1..77 1..77 409 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:13:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI13144-PA 77 GI13144-PA 1..77 1..77 380 89.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL18044-PA 175 GL18044-PA 1..75 1..74 308 78.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:13:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20942-PA 77 GA20942-PA 1..77 1..77 382 89.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25006-PA 77 GM25006-PA 1..77 1..77 399 96.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14042-PA 77 GD14042-PA 1..77 1..77 413 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:13:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ13892-PA 77 GJ13892-PA 1..77 1..77 385 90.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK20584-PA 77 GK20584-PA 1..77 1..77 384 90.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:13:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21646-PA 77 GE21646-PA 1..77 1..77 390 93.5 Plus