Clone RE23430 Report

Search the DGRC for RE23430

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:234
Well:30
Vector:pFlc-1
Associated Gene/TranscriptCG42343-RD
Protein status:RE23430.pep: gold
Preliminary Size:423
Sequenced Size:1569

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG12565 2001-12-14 Blastp of sequenced clone
CG12565 2002-01-01 Sim4 clustering to Release 2
CG12565 2003-01-01 Sim4 clustering to Release 3
CG12565 2008-04-29 Release 5.5 accounting
CG42343 2008-08-15 Release 5.9 accounting
CG42343 2008-12-18 5.12 accounting

Clone Sequence Records

RE23430.complete Sequence

1569 bp (1569 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071183

> RE23430.complete
AGTGCTCGGGCAACTTCCTAGCGCGTCGGTTCAGTTCAGTCCAGTGGATT
CGAGACACGAAAGGACTCAGTTTCAAACTAAAAATTCCAAAGTTTCGAAA
ACGGGTTTCGAGTGGCGCGAAACAACAACGATACAATGATACAATTACTC
TAGCTGAAAGTCGAGAGAAGAGTTTTTGACAAGTGTTAGTTGATTATTTT
CAAGTTTTTTTTTAGTGTTGGCCAGTGCTTTGGACTAGTTTCGAAGCTTT
GCTTGTTTTTTCGAACAAGCATCCCCATCAAAGTAAACACATGAGAAGTC
ATGCTAATGGAAGCTAGGACAGTATTATGATGAACTTGCTGGTGGTGAAG
GAGAGCGGCGAGCGGATCGCCGACATCAGCTGTAGCCAGGAGCATACTAC
CAAATTTTCACCAAAATTGTCCCAAGTAGCCAAACATCGCAAGCTGGCGC
AGCTCGAGATTGCATCAGGTTCGGGATTGGTGGGATTAGGAACGGGAACT
GGTACCGGAAGTGGGTGTGGTCCAGCTATTCGGTGGCAGCTATTGCTACT
GCTCTTGCTCGGTAACTGCATTGATCTTACCGTTTCGAACAAAATCTCCT
CAGTGGGCGCCTTCGAGCCGGACTTTGTGATTCCGCTGGAGAACGTGACC
ATCGCCCAAGGTCGGGACGCGACCTTCACGTGCGTGGTGAACAACCTCGG
TGGTCATCGGGTGAGTGGTGACGGTTCGTCAGCCCCAGCCAAGGTATGTA
TCGGTTTCAAGCGCAGCGTTGAATTCTCAACTTCCGTTCCGTTTCGATTA
GTTCCGGTTCGTTTCGTTTCGTTTCAACTCCTTTCGTTTTGTCCCCGATC
TCTTTCGTTCTGTTTGATTTGTCATTTCAAGTGCACAATATGCATATAAC
TAATACAGTTTTAACGATTTTCCAATCTAAAAGGCACCAATAACAATAAC
GAGTTCCCAACTGCACCACAATTATCGCAATTATGTAACCGTTAAGCGCA
CCTATTCCTATTATACGCATATCTATAGTTAACTACCAGTATAACAATCA
TAGCACCATACAATATTTACTATATATATAGTACCCACAAAAAATATGTA
TATAGAGCACTCTGCATATTAAACGCCTCGATGCACAGCAACAGCAACAG
CAACAGCAACGACTGAGGCAAAAGGACCAAACAATAACAGTAGCGAAAAT
TTCAACAATCGCATTGAATCGATTTCGAATCGATTTGAATCGCATCGACG
AATCGAACAGCGGCATCAAAATAAATTTAAATAAACATGACACAATTTGT
GCGATGCGAAACCGAAAACGAAATATGCATACCTTATTGTTTTTATCATC
GTATTATATTATTATTAGCACTCACATTTAATTTATAACACTCACAAAGC
GGGGAGTCCGGGGACCCGGGGATGCGGGGATCCGGGTTCCCGACTCCGGC
ATTGTGCCAAAGAATTTAAGCGATAAAAGAGCAGCGCACAAAAACTACCA
GCTGAAAGCGATTGTTGTTAACAACAATAAACAATCGTGAATCGTTAAAA
CACAAAAAAAAAAAAAAAA

RE23430.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:33
Subject Length Description Subject Range Query Range Score Percent Strand
CG42343-RD 1565 CG42343-RD 1..1561 1..1561 7790 99.9 Plus
CG42343-RE 1480 CG42343-RE 185..1476 270..1561 6445 99.9 Plus
CG42343-RC 2321 CG42343-RC 22..766 1..745 3725 100 Plus
CG42343-RE 1480 CG42343-RE 1..184 1..184 920 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:26
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 21305933..21306913 1553..573 4890 99.9 Minus
chrX 22417052 chrX 21307580..21307885 573..268 1530 100 Minus
chrX 22417052 chrX 21322624..21322892 269..1 1345 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:06 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:22
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 21440767..21441755 1561..573 4930 99.9 Minus
X 23542271 X 21442422..21442727 573..268 1530 100 Minus
X 23542271 X 21457466..21457734 269..1 1345 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:30
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 21425859..21426847 1561..573 4930 99.8 Minus
X 23527363 X 21427514..21427819 573..268 1530 100 Minus
X 23527363 X 21442558..21442826 269..1 1345 100 Minus
Blast to na_te.dros performed 2019-03-16 19:28:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2381..2461 1135..1213 166 69.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6704..6804 1112..1213 165 63.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2596..2681 1137..1223 163 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6782..6858 1136..1213 153 67.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2370..2434 1136..1198 149 72.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2361..2432 1136..1208 146 68.5 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6834 1136..1213 146 69.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2328..2413 1136..1213 141 68.6 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6770..6852 1136..1213 141 68.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6803..6880 1136..1214 140 65.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6800 1136..1194 138 72.1 Plus
roo 9092 roo DM_ROO 9092bp 1130..1179 1136..1187 138 76.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2355..2429 1136..1208 136 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2316..2392 1136..1213 135 65.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2321..2393 1135..1208 133 66.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2349..2420 1136..1208 129 68 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2834..2996 1123..1284 128 58.3 Plus
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1041..1126 1309..1392 128 64.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6808..6873 1135..1198 127 68.2 Plus
roo 9092 roo DM_ROO 9092bp 1097..1154 1136..1188 125 74.1 Plus
roo 9092 roo DM_ROO 9092bp 1091..1161 1136..1207 123 65.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2910..2996 1112..1199 122 61.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6733..6813 1135..1213 121 63 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6869..6922 1136..1190 119 70.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2393..2556 1135..1287 118 57.3 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6875..6919 1136..1180 117 73.3 Plus
roo 9092 roo DM_ROO 9092bp 1085..1158 1136..1207 113 65.3 Plus

RE23430.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:34 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 21306705..21306912 574..781 100 <- Minus
chrX 21307580..21307883 270..573 100 <- Minus
chrX 21322624..21322892 1..269 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2010-07-28 16:34:01 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RE 1..573 327..899 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:19 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RE 1..573 327..899 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:09 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 1..573 327..899 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:37 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RE 1..573 327..899 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:32:56 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 1..573 327..899 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2010-07-28 16:34:01 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 1..1553 1..1553 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:19 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 1..1553 1..1553 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:09 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 5..1557 1..1553 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:37 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 1..1553 1..1553 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:32:56 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
CG42343-RD 5..1557 1..1553 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:34 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
X 21440775..21441754 574..1553 99 <- Minus
X 21442422..21442725 270..573 100 <- Minus
X 21457466..21457734 1..269 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:34 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
X 21440775..21441754 574..1553 99 <- Minus
X 21442422..21442725 270..573 100 <- Minus
X 21457466..21457734 1..269 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:34 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
X 21440775..21441754 574..1553 99 <- Minus
X 21442422..21442725 270..573 100 <- Minus
X 21457466..21457734 1..269 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:09 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 21328493..21328761 1..269 100   Minus
arm_X 21311802..21312781 574..1553 99 <- Minus
arm_X 21313449..21313752 270..573 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:31 Download gff for RE23430.complete
Subject Subject Range Query Range Percent Splice Strand
X 21425867..21426846 574..1553 99 <- Minus
X 21427514..21427817 270..573 100 <- Minus
X 21442558..21442826 1..269 100   Minus

RE23430.pep Sequence

Translation from 326 to 898

> RE23430.pep
MMNLLVVKESGERIADISCSQEHTTKFSPKLSQVAKHRKLAQLEIASGSG
LVGLGTGTGTGSGCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDF
VIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVCIGFKRSVEF
STSVPFRLVPVRFVSFQLLSFCPRSLSFCLICHFKCTICI*

RE23430.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:01:26
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF21351-PA 146 GF21351-PA 1..132 1..144 402 70.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:01:27
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17534-PA 170 GG17534-PA 1..169 1..163 665 88.2 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:37
Subject Length Description Subject Range Query Range Score Percent Strand
DIP-beta-PE 190 CG12565-PB 1..190 1..190 983 100 Plus
DIP-beta-PD 190 CG12565-PA 1..190 1..190 983 100 Plus
DIP-beta-PF 555 CG42343-PF 1..140 1..140 712 100 Plus
DIP-beta-PC 555 CG42343-PC 1..140 1..140 712 100 Plus
DIP-beta-PG 534 CG42343-PG 1..132 1..142 595 85.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:01:28
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15978-PA 144 GL15978-PA 1..144 2..149 318 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22891-PA 197 GA22891-PA 79..152 70..153 260 65.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM22618-PA 160 GM22618-PA 1..159 1..158 649 95 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:01:29
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15494-PA 74 GD15494-PA 8..73 93..158 337 97 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:01:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15564-PA 183 GJ15564-PA 66..154 38..147 279 62.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:01:31
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15297-PA 203 GE15297-PA 1..193 1..180 665 79.3 Plus

RE23430.hyp Sequence

Translation from 326 to 898

> RE23430.hyp
MMNLLVVKESGERIADISCSQEHTTKFSPKLSQVAKHRKLAQLEIASGSG
LVGLGTGTGTGSGCGPAIRWQLLLLLLLGNCIDLTVSNKISSVGAFEPDF
VIPLENVTIAQGRDATFTCVVNNLGGHRVSGDGSSAPAKVCIGFKRSVEF
STSVPFRLVPVRFVSFQLLSFCPRSLSFCLICHFKCTICI*

RE23430.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:49:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42343-PE 190 CG12565-PB 1..190 1..190 983 100 Plus
CG42343-PD 190 CG12565-PA 1..190 1..190 983 100 Plus
CG42343-PF 555 CG42343-PF 1..140 1..140 712 100 Plus
CG42343-PC 555 CG42343-PC 1..140 1..140 712 100 Plus
CG42343-PG 534 CG42343-PG 1..132 1..142 595 85.9 Plus