BDGP Sequence Production Resources |
Search the DGRC for RE23482
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 234 |
Well: | 82 |
Vector: | pFlc-1 |
Associated Gene/Transcript | mRpS21-RA |
Protein status: | RE23482.pep: gold |
Sequenced Size: | 423 |
Gene | Date | Evidence |
---|---|---|
CG32854 | 2002-09-02 | Blastp of sequenced clone |
CG32854 | 2003-01-01 | Sim4 clustering to Release 3 |
mRpS21 | 2008-04-29 | Release 5.5 accounting |
mRpS21 | 2008-08-15 | Release 5.9 accounting |
mRpS21 | 2008-12-18 | 5.12 accounting |
423 bp (423 high quality bases) assembled on 2002-09-02
GenBank Submission: BT001577
> RE23482.complete GACAGTAAATGGTCACACTGTTTTGAAAGCCGATTATTTAATAAACATTT GGAAAACTTTATAAAATAAAACTACTTATCCGAAATGAGACACGTGCAGT TTCTGGCCCGCACCGTTCTGGTGCAAAACAATAATGTGGAGGAGGCGTGT CGTCTGTTAAATCGCGTCTTGGGAAAAGAAGAACTGCTCGACCAATTTCG CCGCACGCGATTCTACGAAAAGCCGTATCAGGTTCGTCGTCGCATCAACT TCGAGAAATGCAAGGCCATTTACAACGAGGACATGAACCGAAAAATTCAG TTCGTACTGCGCAAAAATCGCGCCGAACCTTTTCCTGGATGCAGTTAAAC TAGTTTTTGAGGCAATAAAATGTAGGAATTAAATAAATTGCTTATTTTCT AGTACGGAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS21-RA | 502 | mRpS21-RA | 45..449 | 2..406 | 2025 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Doc | 4725 | Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). | 978..1019 | 51..92 | 111 | 73.8 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3R | 9206522..9206698 | 232..407 | 99 | <- | Minus |
chr3R | 9206758..9206987 | 1..231 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..264 | 85..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..264 | 85..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..264 | 85..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..264 | 85..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..264 | 85..348 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..405 | 2..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..405 | 2..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 16..422 | 1..406 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 1..405 | 2..406 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
mRpS21-RA | 16..422 | 1..406 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13381327..13381503 | 232..407 | 99 | <- | Minus |
3R | 13381563..13381792 | 1..231 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13381327..13381503 | 232..407 | 99 | <- | Minus |
3R | 13381563..13381792 | 1..231 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13381327..13381503 | 232..407 | 99 | <- | Minus |
3R | 13381563..13381792 | 1..231 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3R | 9207049..9207225 | 232..407 | 99 | <- | Minus |
arm_3R | 9207285..9207514 | 1..231 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3R | 13122394..13122623 | 1..231 | 99 | Minus | |
3R | 13122158..13122334 | 232..407 | 99 | <- | Minus |
Translation from 84 to 347
> RE23482.pep MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF17387-PA | 87 | GF17387-PA | 1..87 | 1..87 | 441 | 97.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17058-PA | 87 | GG17058-PA | 1..87 | 1..87 | 445 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18548-PA | 87 | GH18548-PA | 1..87 | 1..87 | 419 | 89.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
mRpS21-PB | 87 | CG32854-PB | 1..87 | 1..87 | 457 | 100 | Plus |
mRpS21-PA | 87 | CG32854-PA | 1..87 | 1..87 | 457 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI23247-PA | 87 | GI23247-PA | 1..87 | 1..87 | 413 | 87.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL23067-PA | 87 | GL23067-PA | 1..87 | 1..87 | 439 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA27131-PA | 87 | GA27131-PA | 1..87 | 1..87 | 439 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25944-PA | 87 | GM25944-PA | 1..87 | 1..87 | 449 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD20504-PA | 87 | GD20504-PA | 1..87 | 1..87 | 449 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ10744-PA | 87 | GJ10744-PA | 1..87 | 1..87 | 418 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13350-PA | 87 | GK13350-PA | 1..87 | 1..87 | 435 | 95.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24447-PA | 87 | GE24447-PA | 1..87 | 1..87 | 445 | 98.9 | Plus |
Translation from 84 to 347
> RE23482.hyp MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*