Clone RE23482 Report

Search the DGRC for RE23482

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:234
Well:82
Vector:pFlc-1
Associated Gene/TranscriptmRpS21-RA
Protein status:RE23482.pep: gold
Sequenced Size:423

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG32854 2002-09-02 Blastp of sequenced clone
CG32854 2003-01-01 Sim4 clustering to Release 3
mRpS21 2008-04-29 Release 5.5 accounting
mRpS21 2008-08-15 Release 5.9 accounting
mRpS21 2008-12-18 5.12 accounting

Clone Sequence Records

RE23482.complete Sequence

423 bp (423 high quality bases) assembled on 2002-09-02

GenBank Submission: BT001577

> RE23482.complete
GACAGTAAATGGTCACACTGTTTTGAAAGCCGATTATTTAATAAACATTT
GGAAAACTTTATAAAATAAAACTACTTATCCGAAATGAGACACGTGCAGT
TTCTGGCCCGCACCGTTCTGGTGCAAAACAATAATGTGGAGGAGGCGTGT
CGTCTGTTAAATCGCGTCTTGGGAAAAGAAGAACTGCTCGACCAATTTCG
CCGCACGCGATTCTACGAAAAGCCGTATCAGGTTCGTCGTCGCATCAACT
TCGAGAAATGCAAGGCCATTTACAACGAGGACATGAACCGAAAAATTCAG
TTCGTACTGCGCAAAAATCGCGCCGAACCTTTTCCTGGATGCAGTTAAAC
TAGTTTTTGAGGCAATAAAATGTAGGAATTAAATAAATTGCTTATTTTCT
AGTACGGAAAAAAAAAAAAAAAA

RE23482.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:00:25
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-RA 502 mRpS21-RA 45..449 2..406 2025 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 9206753..9206987 236..2 1175 100 Minus
chr3R 27901430 chr3R 9206524..9206700 406..230 885 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:08 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13381558..13381792 236..2 1175 100 Minus
3R 32079331 3R 13381329..13381505 406..230 885 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:19:07
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 13122389..13122623 236..2 1175 100 Minus
3R 31820162 3R 13122160..13122336 406..230 885 100 Minus
Blast to na_te.dros performed 2019-03-16 22:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
Doc 4725 Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). 978..1019 51..92 111 73.8 Plus

RE23482.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:48:17 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 9206522..9206698 232..407 99 <- Minus
chr3R 9206758..9206987 1..231 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:15 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 85..348 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:00:18 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 85..348 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:16:07 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 85..348 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:44:18 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 85..348 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:42:29 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..264 85..348 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:15:48 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..405 2..406 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:00:18 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..405 2..406 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:16:07 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 16..422 1..406 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:44:18 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 1..405 2..406 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:42:29 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
mRpS21-RA 16..422 1..406 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:17 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13381327..13381503 232..407 99 <- Minus
3R 13381563..13381792 1..231 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:17 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13381327..13381503 232..407 99 <- Minus
3R 13381563..13381792 1..231 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:17 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13381327..13381503 232..407 99 <- Minus
3R 13381563..13381792 1..231 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:16:07 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9207049..9207225 232..407 99 <- Minus
arm_3R 9207285..9207514 1..231 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:27:17 Download gff for RE23482.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13122394..13122623 1..231 99   Minus
3R 13122158..13122334 232..407 99 <- Minus

RE23482.pep Sequence

Translation from 84 to 347

> RE23482.pep
MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV
RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*

RE23482.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 17:15:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17387-PA 87 GF17387-PA 1..87 1..87 441 97.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 17:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17058-PA 87 GG17058-PA 1..87 1..87 445 98.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 17:15:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18548-PA 87 GH18548-PA 1..87 1..87 419 89.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:13:02
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-PB 87 CG32854-PB 1..87 1..87 457 100 Plus
mRpS21-PA 87 CG32854-PA 1..87 1..87 457 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 17:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23247-PA 87 GI23247-PA 1..87 1..87 413 87.4 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 17:15:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL23067-PA 87 GL23067-PA 1..87 1..87 439 95.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 17:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA27131-PA 87 GA27131-PA 1..87 1..87 439 95.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 17:15:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25944-PA 87 GM25944-PA 1..87 1..87 449 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 17:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20504-PA 87 GD20504-PA 1..87 1..87 449 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 17:15:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10744-PA 87 GJ10744-PA 1..87 1..87 418 88.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 17:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13350-PA 87 GK13350-PA 1..87 1..87 435 95.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 17:15:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24447-PA 87 GE24447-PA 1..87 1..87 445 98.9 Plus

RE23482.hyp Sequence

Translation from 84 to 347

> RE23482.hyp
MRHVQFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQV
RRRINFEKCKAIYNEDMNRKIQFVLRKNRAEPFPGCS*

RE23482.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:15:22
Subject Length Description Subject Range Query Range Score Percent Strand
mRpS21-PB 87 CG32854-PB 1..87 1..87 457 100 Plus
mRpS21-PA 87 CG32854-PA 1..87 1..87 457 100 Plus