Clone RE23556 Report

Search the DGRC for RE23556

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:235
Well:56
Vector:pFlc-1
Associated Gene/TranscriptCG5160-RA
Protein status:RE23556.pep: gold
Preliminary Size:1078
Sequenced Size:1282

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5160 2001-12-14 Blastp of sequenced clone
CG5160 2002-01-01 Sim4 clustering to Release 2
CG5160 2003-01-01 Sim4 clustering to Release 3
CG5160 2008-04-29 Release 5.5 accounting
CG5160 2008-08-15 Release 5.9 accounting
CG5160 2008-12-18 5.12 accounting

Clone Sequence Records

RE23556.complete Sequence

1282 bp (1282 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071187

> RE23556.complete
GATAGCAAACAGGAAGCTGAAGTGTCAACAACTCGCCAAAAAAATAAATC
AAAAAATATTAAATTTAAAGCAGCGCGACTCGTGAAACTATTGTAATTCG
AATACAAAATGAAAATCTAGCAAAACAATACAGTTTTGCGGAAAACATAA
ACTTGTTTCGCCCAACGACAATTGCCCCTGTTATCTGCCATGAATGCCAC
CTCGCCAAAGTCATCGCTGGTCAAGTTGGGTCTGCATACCAATAAACAAA
AGACTCTGAAGGTTATGGTCCTGGGCCAAAGTGGTGTGGGAAAAACGGCC
ATGGTGGTGCGTTTTATTACCCGACGCTTCATTGGCGAGTATGATCCTAA
TCTGGAGAAGATTTACACCTGCCAAACCACGCTGGACAAGGAGCAGATTC
AGTTTGACATTCTGGACGCCACCGGTCAGCTACAAGAACTAGATGGAGTT
AGTCTGGAGTCCAACATCCGCTGGGCCGACGCATTTATACTAATGTACTC
CATTACGGACAAGTGTTCCTTCGACGAGTGCAGTCGCCTAAAGTTCCTCA
TCAATTACAATAAACGAAGACGCAAGTTGGGCTCGGCCAGTAAAGAATAC
GCACTGGATATTCCTGTCATACTGGTGGGCAATAAGACAGATCAGCCGGG
CGATCGAATGGTCAGCTTGGAAGAGGGTCAGCGCCGATTCAGGGAGTTAT
CCTGCTCCTGTTTTCACGAGATTTCCGTCAGAGAGAGCGTGGATCAAGTG
CAGAATGTTTTTCGCGATGTGTTTCGCTTCTGGCGAGTCTTCAGCAAATT
CCCCAAGCTCAAGCGCTCCACCAGCGATGTGGCCAATACGGATGGAATCC
TCACGCCCGATTCGGGATCCTGTTCCTTCTACGATGCCTCGTCTTTGGGC
GTCGGTCGACATTCCTTTCTGGTCATCGGAAGCGCCTGTTTGGAGGAGAG
CAACGGTGACCATACGGAGTCTACGGATGAGATTACGAGTAGCAGTTTGA
GCAGCTCACGCAGCGACATCGATGCTCCCTTCCGTAGTAGAGCTTCGACG
GACGGCACCCTGTTGTCCCGACCACGTAGATGGCGGTATCCACCGCCGGG
ATGCCTGCTGCCACACACGAATCGCGTGGAGCGACGGATGAGCATTTCCA
CCAGGGGCAGTAATGCCAGTTACTAGAGTGGAATTTTATGCAGGGTGGGT
CGAGCTTAGTTAGTCAAAATATGTAGCGACAAATATATAATTATATAGCT
AGATGTTATTGTCATAGAAAAAAAAAAAAAAA

RE23556.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:22
Subject Length Description Subject Range Query Range Score Percent Strand
CG5160.a 1753 CG5160.a 469..1738 2..1271 6335 99.9 Plus
CG5160-RA 1285 CG5160-RA 1..1270 2..1271 6335 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:38:59
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 7390020..7390537 1265..748 2590 100 Minus
chr2L 23010047 chr2L 7390893..7391052 595..436 785 99.4 Minus
chr2L 23010047 chr2L 7390677..7390831 749..595 760 99.4 Minus
chr2L 23010047 chr2L 7391108..7391246 436..298 695 100 Minus
chr2L 23010047 chr2L 7397278..7397438 167..2 690 95.8 Minus
chr2L 23010047 chr2L 7391307..7391438 298..167 660 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:12 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:38:57
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7390980..7391503 1271..748 2605 99.8 Minus
2L 23513712 2L 7398238..7398403 167..2 830 100 Minus
2L 23513712 2L 7391860..7392019 595..436 800 100 Minus
2L 23513712 2L 7391644..7391798 749..595 775 100 Minus
2L 23513712 2L 7392075..7392213 436..298 695 100 Minus
2L 23513712 2L 7392274..7392405 298..167 660 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7390980..7391503 1271..748 2605 99.8 Minus
2L 23513712 2L 7398238..7398403 167..2 830 100 Minus
2L 23513712 2L 7391860..7392019 595..436 800 100 Minus
2L 23513712 2L 7391644..7391798 749..595 775 100 Minus
2L 23513712 2L 7392075..7392213 436..298 695 100 Minus
2L 23513712 2L 7392274..7392405 298..167 660 100 Minus
Blast to na_te.dros performed on 2019-03-15 22:38:57 has no hits.

RE23556.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:39:38 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 7390018..7390537 748..1267 99 <- Minus
chr2L 7390679..7390831 595..747 99 <- Minus
chr2L 7390894..7391052 436..594 99 <- Minus
chr2L 7391109..7391245 299..435 100 <- Minus
chr2L 7391307..7391437 168..298 100 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:19 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..987 190..1176 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:33 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RB 1..987 190..1176 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:00 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..987 190..1176 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:31:02 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..987 190..1176 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:47 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..987 190..1176 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:54 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..1265 2..1267 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:33 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..1265 2..1267 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:00 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 347..1612 1..1267 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:31:03 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 1..1265 2..1267 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:47 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
CG5160-RA 347..1612 1..1267 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:38 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390984..7391503 748..1267 99 <- Minus
2L 7391646..7391798 595..747 100 <- Minus
2L 7391861..7392019 436..594 100 <- Minus
2L 7392076..7392212 299..435 100 <- Minus
2L 7392274..7392404 168..298 100 <- Minus
2L 7398238..7398403 1..167 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:38 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390984..7391503 748..1267 99 <- Minus
2L 7391646..7391798 595..747 100 <- Minus
2L 7391861..7392019 436..594 100 <- Minus
2L 7392076..7392212 299..435 100 <- Minus
2L 7392274..7392404 168..298 100 <- Minus
2L 7398238..7398403 1..167 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:39:38 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7390984..7391503 748..1267 99 <- Minus
2L 7391646..7391798 595..747 100 <- Minus
2L 7391861..7392019 436..594 100 <- Minus
2L 7392076..7392212 299..435 100 <- Minus
2L 7392274..7392404 168..298 100 <- Minus
2L 7398238..7398403 1..167 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:00 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7392274..7392404 168..298 100 <- Minus
arm_2L 7398238..7398403 1..167 99   Minus
arm_2L 7390984..7391503 748..1267 99 <- Minus
arm_2L 7391646..7391798 595..747 100 <- Minus
arm_2L 7391861..7392019 436..594 100 <- Minus
arm_2L 7392076..7392212 299..435 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:31 Download gff for RE23556.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7392076..7392212 299..435 100 <- Minus
2L 7392274..7392404 168..298 100 <- Minus
2L 7398238..7398403 1..167 99   Minus
2L 7390984..7391503 748..1267 99 <- Minus
2L 7391646..7391798 595..747 100 <- Minus
2L 7391861..7392019 436..594 100 <- Minus

RE23556.pep Sequence

Translation from 189 to 1175

> RE23556.pep
MNATSPKSSLVKLGLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGE
YDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVSLESNIRWADAFI
LMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKT
DQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRV
FSKFPKLKRSTSDVANTDGILTPDSGSCSFYDASSLGVGRHSFLVIGSAC
LEESNGDHTESTDEITSSSLSSSRSDIDAPFRSRASTDGTLLSRPRRWRY
PPPGCLLPHTNRVERRMSISTRGSNASY*

RE23556.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14027-PA 329 GF14027-PA 1..329 1..328 1674 95.7 Plus
Dana\GF23546-PA 206 GF23546-PA 15..168 23..194 271 37.8 Plus
Dana\GF13570-PA 257 GF13570-PA 51..205 21..187 239 32.7 Plus
Dana\GF24954-PA 184 GF24954-PA 5..162 24..196 209 32.9 Plus
Dana\GF10554-PA 192 GF10554-PA 2..170 19..202 198 34.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23535-PA 328 GG23535-PA 1..328 1..328 1733 99.1 Plus
Dere\GG14386-PA 207 GG14386-PA 16..169 23..194 270 37.8 Plus
Dere\GG22302-PA 264 GG22302-PA 58..212 21..187 240 32.7 Plus
Dere\GG14553-PA 184 GG14553-PA 5..162 24..196 210 32.9 Plus
Dere\GG18572-PA 235 GG18572-PA 13..185 24..219 193 33.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:50:39
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13149-PA 329 GH13149-PA 1..329 1..328 1456 89.7 Plus
Dgri\GH15851-PA 207 GH15851-PA 16..169 23..194 267 37.2 Plus
Dgri\GH19819-PA 265 GH19819-PA 61..215 21..187 241 33.3 Plus
Dgri\GH15039-PA 184 GH15039-PA 5..162 24..196 211 32.9 Plus
Dgri\GH15920-PA 192 GH15920-PA 2..170 19..202 200 34.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:26:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG5160-PB 328 CG5160-PB 1..328 1..328 1694 100 Plus
CG5160-PA 328 CG5160-PA 1..328 1..328 1694 100 Plus
CG8519-PA 207 CG8519-PA 16..169 23..194 264 36.6 Plus
Ric-PB 264 CG8418-PB 58..211 21..186 237 32.3 Plus
Ric-PA 264 CG8418-PA 58..211 21..186 237 32.3 Plus
Ras64B-PA 192 CG1167-PA 2..169 19..201 227 33.3 Plus
Rap1-PC 184 CG1956-PC 5..173 24..209 214 31.7 Plus
Rap1-PB 184 CG1956-PB 5..173 24..209 214 31.7 Plus
Rap1-PA 184 CG1956-PA 5..173 24..209 214 31.7 Plus
Rap2l-PA 182 CG3204-PA 2..162 21..196 194 33.5 Plus
Rala-PB 197 CG2849-PB 13..172 24..194 190 32.2 Plus
Rala-PC 201 CG2849-PC 13..185 24..219 190 31.8 Plus
Rala-PA 201 CG2849-PA 13..185 24..219 190 31.8 Plus
Ras85D-PA 189 CG9375-PA 5..119 24..151 179 31.2 Plus
Rheb-PB 182 CG1081-PB 4..162 21..194 164 28.2 Plus
Rheb-PA 182 CG1081-PA 4..162 21..194 164 28.2 Plus
CG8500-PB 233 CG8500-PB 20..216 24..226 163 30 Plus
CG8500-PA 233 CG8500-PA 20..216 24..226 163 30 Plus
RhoL-PA 190 CG9366-PA 6..173 17..196 158 24.9 Plus
RhoL-PB 214 CG9366-PB 30..197 17..196 158 24.9 Plus
CG8641-PB 434 CG8641-PB 168..338 24..195 156 29.9 Plus
CG8641-PA 434 CG8641-PA 168..338 24..195 156 29.9 Plus
CG8519-PB 151 CG8519-PB 2..113 65..194 155 33.1 Plus
Rab23-PA 268 CG2108-PA 38..191 23..192 150 29.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:50:40
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI17789-PA 329 GI17789-PA 1..329 1..328 1531 91.2 Plus
Dmoj\GI12632-PA 207 GI12632-PA 16..169 23..194 266 37.2 Plus
Dmoj\GI20407-PA 267 GI20407-PA 61..215 21..187 240 32.7 Plus
Dmoj\GI16691-PA 184 GI16691-PA 5..162 24..196 206 32.4 Plus
Dmoj\GI16572-PA 192 GI16572-PA 2..170 19..202 198 33.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25936-PA 330 GL25936-PA 1..330 1..328 1675 96.1 Plus
Dper\GL13274-PA 207 GL13274-PA 16..169 23..194 265 36.6 Plus
Dper\GL19979-PA 262 GL19979-PA 58..212 21..187 236 32.1 Plus
Dper\GL23727-PA 200 GL23727-PA 13..170 24..196 212 33.5 Plus
Dper\GL12826-PA 174 GL12826-PA 11..160 35..199 189 32.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:50:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA18698-PA 330 GA18698-PA 1..330 1..328 1675 96.1 Plus
Dpse\GA21132-PA 207 GA21132-PA 16..169 23..194 265 36.6 Plus
Dpse\GA21063-PA 262 GA21063-PA 58..212 21..187 236 32.1 Plus
Dpse\GA15150-PA 184 GA15150-PA 5..162 24..196 210 32.9 Plus
Dpse\GA26719-PA 200 GA26719-PA 13..170 24..196 207 32.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13567-PA 328 GM13567-PA 1..328 1..328 1739 99.1 Plus
Dsec\GM20091-PA 264 GM20091-PA 58..212 21..187 240 32.7 Plus
Dsec\GM14794-PA 196 GM14794-PA 11..158 29..194 226 34.3 Plus
Dsec\GM14161-PA 184 GM14161-PA 5..162 24..196 210 32.9 Plus
Dsec\GM12716-PA 235 GM12716-PA 13..185 24..219 193 33.2 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:50:42
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22497-PA 328 GD22497-PA 1..328 1..328 1741 99.4 Plus
Dsim\GD25569-PA 264 GD25569-PA 58..212 21..187 240 32.7 Plus
Dsim\GD13966-PA 196 GD13966-PA 11..158 29..194 226 34.3 Plus
Dsim\R-PA 184 GD13432-PA 5..162 24..196 210 32.9 Plus
Dsim\GD16321-PA 235 GD16321-PA 13..185 24..219 193 33.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17614-PA 330 GJ17614-PA 1..330 1..328 1499 92.4 Plus
Dvir\GJ12755-PA 207 GJ12755-PA 16..169 23..194 275 38.4 Plus
Dvir\GJ20079-PA 267 GJ20079-PA 61..215 21..187 241 33.3 Plus
Dvir\GJ12943-PA 184 GJ12943-PA 5..162 24..196 206 32.4 Plus
Dvir\GJ12824-PA 192 GJ12824-PA 2..170 19..202 199 33.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:50:43
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24726-PA 329 GK24726-PA 1..329 1..328 1524 91.5 Plus
Dwil\GK12552-PA 204 GK12552-PA 27..166 37..194 228 36.1 Plus
Dwil\GK20561-PA 184 GK20561-PA 5..162 24..196 210 32.9 Plus
Dwil\GK12838-PA 192 GK12838-PA 2..170 19..202 198 33.9 Plus
Dwil\GK24932-PA 235 GK24932-PA 13..185 24..219 196 33.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE18361-PA 328 GE18361-PA 1..328 1..328 1732 98.8 Plus
Dyak\GE21573-PA 207 GE21573-PA 16..169 23..194 270 37.8 Plus
Dyak\GE14098-PA 264 GE14098-PA 58..212 21..187 240 32.7 Plus
Dyak\GE20907-PA 184 GE20907-PA 5..162 24..196 210 32.9 Plus
Dyak\GE16885-PA 235 GE16885-PA 13..185 24..219 193 33.2 Plus

RE23556.hyp Sequence

Translation from 189 to 1175

> RE23556.hyp
MNATSPKSSLVKLGLHTNKQKTLKVMVLGQSGVGKTAMVVRFITRRFIGE
YDPNLEKIYTCQTTLDKEQIQFDILDATGQLQELDGVSLESNIRWADAFI
LMYSITDKCSFDECSRLKFLINYNKRRRKLGSASKEYALDIPVILVGNKT
DQPGDRMVSLEEGQRRFRELSCSCFHEISVRESVDQVQNVFRDVFRFWRV
FSKFPKLKRSTSDVANTDGILTPDSGSCSFYDASSLGVGRHSFLVIGSAC
LEESNGDHTESTDEITSSSLSSSRSDIDAPFRSRASTDGTLLSRPRRWRY
PPPGCLLPHTNRVERRMSISTRGSNASY*

RE23556.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:18:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG5160-PB 328 CG5160-PB 1..328 1..328 1694 100 Plus
CG5160-PA 328 CG5160-PA 1..328 1..328 1694 100 Plus
CG8519-PA 207 CG8519-PA 16..169 23..194 264 36.6 Plus
Ric-PB 264 CG8418-PB 58..211 21..186 237 32.3 Plus
Ric-PA 264 CG8418-PA 58..211 21..186 237 32.3 Plus