Clone RE23580 Report

Search the DGRC for RE23580

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:235
Well:80
Vector:pFlc-1
Associated Gene/TranscriptCG14898-RA
Protein status:RE23580.pep: gold
Preliminary Size:348
Sequenced Size:456

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14898 2001-12-14 Blastp of sequenced clone
CG14898 2002-01-01 Sim4 clustering to Release 2
CG14898 2003-01-01 Sim4 clustering to Release 3
CG14898 2008-04-29 Release 5.5 accounting
CG14898 2008-08-15 Release 5.9 accounting
CG14898 2008-12-18 5.12 accounting

Clone Sequence Records

RE23580.complete Sequence

456 bp (456 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071188

> RE23580.complete
TGAGTTTTTAGCCGGCTGCTAAATAGTATAGTATTAGTATGTTATATGAT
ATGAACTCAGGATGTCCAGAATTTTGATGAGCCAACTGACCCACCCTCAG
AGGGTCCGACTGCTGTACAAAACGATCTTGCGACTGCACAGAGGACTTCC
AGCGGAACTTCGTGCTCTGGGCGATAACTATGTGCGGGACGAGTTCCGGC
GACACCTCAAGTGCAATCCCATGGAGGCACAGCTCTTTATGACAGAGTGG
GCCCGATATGCGTCCACAATCACCCAACAACTAGGGATTCGGGGCAAGCC
CAAGGGAGAGCTGGGCGAAGAGATTGACCCCAAGACTGTAGAAATGTTGA
AAGACGACCAAGTAGTCCAACTATACGAGCTGATGCTGGCGGCCAAGGGA
GTAGAAGATGCGCAAGGCAAATAAATCAGTGTATTATTTTAAAAAAAAAA
AAAAAA

RE23580.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:41:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG14898-RA 498 CG14898-RA 60..498 3..441 2195 100 Plus
Dhfr-RA 713 Dhfr-RA 655..713 441..383 295 100 Minus
Dhfr-RB 713 Dhfr-RB 655..713 441..383 295 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 12306538..12306724 440..254 935 100 Minus
chr3R 27901430 chr3R 12306956..12307097 144..3 710 100 Minus
chr3R 27901430 chr3R 12306781..12306892 253..142 560 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:06
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 16481860..16482047 441..254 940 100 Minus
3R 32079331 3R 16482279..16482420 144..3 710 100 Minus
3R 32079331 3R 16482104..16482215 253..142 560 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:08:20
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 16222691..16222878 441..254 940 100 Minus
3R 31820162 3R 16223110..16223251 144..3 710 100 Minus
3R 31820162 3R 16222935..16223046 253..142 560 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:49:07 has no hits.

RE23580.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:49:52 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 12306538..12306724 254..440 100 <- Minus
chr3R 12306781..12306890 144..253 100 <- Minus
chr3R 12306957..12307098 1..143 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:20 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 1..363 62..424 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:06:26 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 1..363 62..424 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:32:59 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 1..363 62..424 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:57 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 1..363 62..424 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:56:57 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 1..363 62..424 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:34:47 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 2..439 3..440 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:06:26 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 2..439 3..440 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:32:59 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 31..470 1..440 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:57 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 2..439 3..440 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:56:57 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
CG14898-RA 31..470 1..440 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:52 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481861..16482047 254..440 100 <- Minus
3R 16482104..16482213 144..253 100 <- Minus
3R 16482280..16482421 1..143 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:52 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481861..16482047 254..440 100 <- Minus
3R 16482104..16482213 144..253 100 <- Minus
3R 16482280..16482421 1..143 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:49:52 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16481861..16482047 254..440 100 <- Minus
3R 16482104..16482213 144..253 100 <- Minus
3R 16482280..16482421 1..143 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:32:59 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 12308002..12308143 1..143 99   Minus
arm_3R 12307583..12307769 254..440 100 <- Minus
arm_3R 12307826..12307935 144..253 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:07:22 Download gff for RE23580.complete
Subject Subject Range Query Range Percent Splice Strand
3R 16222692..16222878 254..440 100 <- Minus
3R 16222935..16223044 144..253 100 <- Minus
3R 16223111..16223252 1..143 99   Minus

RE23580.pep Sequence

Translation from 61 to 423

> RE23580.pep
MSRILMSQLTHPQRVRLLYKTILRLHRGLPAELRALGDNYVRDEFRRHLK
CNPMEAQLFMTEWARYASTITQQLGIRGKPKGELGEEIDPKTVEMLKDDQ
VVQLYELMLAAKGVEDAQGK*

RE23580.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF16511-PA 127 GF16511-PA 1..115 1..115 563 91.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:50:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG19917-PA 120 GG19917-PA 1..120 1..120 620 97.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18290-PA 129 GH18290-PA 1..115 1..115 565 88.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:18:16
Subject Length Description Subject Range Query Range Score Percent Strand
Sdhaf3-PA 120 CG14898-PA 1..120 1..120 616 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24099-PA 129 GI24099-PA 1..114 1..114 536 87.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21649-PA 131 GL21649-PA 1..115 1..115 554 87.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:50:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA26360-PA 131 GA26360-PA 1..115 1..115 546 86.1 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM15427-PA 120 GM15427-PA 1..120 1..120 619 97.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20284-PA 120 GD20284-PA 1..120 1..120 633 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:50:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ10918-PA 129 GJ10918-PA 1..115 1..115 547 87.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK18007-PA 124 GK18007-PA 3..124 6..120 531 82 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:50:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26309-PA 120 GE26309-PA 1..120 1..120 620 97.5 Plus

RE23580.hyp Sequence

Translation from 61 to 423

> RE23580.hyp
MSRILMSQLTHPQRVRLLYKTILRLHRGLPAELRALGDNYVRDEFRRHLK
CNPMEAQLFMTEWARYASTITQQLGIRGKPKGELGEEIDPKTVEMLKDDQ
VVQLYELMLAAKGVEDAQGK*

RE23580.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 13:41:02
Subject Length Description Subject Range Query Range Score Percent Strand
CG14898-PA 120 CG14898-PA 1..120 1..120 616 100 Plus