BDGP Sequence Production Resources |
Search the DGRC for RE23595
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 235 |
Well: | 95 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL37A-RA |
Protein status: | RE23595.pep: gold |
Sequenced Size: | 519 |
Gene | Date | Evidence |
---|---|---|
CG5827 | 2001-12-14 | Blastp of sequenced clone |
CG5827 | 2002-01-01 | Sim4 clustering to Release 2 |
CG5827 | 2003-01-01 | Sim4 clustering to Release 3 |
RpL37A | 2008-04-29 | Release 5.5 accounting |
RpL37A | 2008-08-15 | Release 5.9 accounting |
RpL37A | 2008-12-18 | 5.12 accounting |
519 bp (519 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071189
> RE23595.complete CTTTTTTCGATTTTTCGTTTCCGGCGTAATACTGCTGGCGAATCTTTCCC GTGTCTAACACACCAACAACAACAGCAAAATGGCCAAGCGCACCAAGAAG GTTGGAATCGTTGGTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAA GATGGTCAAGAAGATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCT TCTGCGGCAAGGACTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGC AAGCGCTGCAAAAGGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCAC CGCCGCCGCCTCCGTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGG AACAGTAAACATAAACGGATCATTAATGATGGAACCATCTAATTGAATGC TCCGCTATGCTAGCTCCCGTAGTTTTAATCTGACAACGCGATTTTCCTGT GGTTTGCGCCGTGCCGGTCATGTGAAAATAAAAAAAAATGTTTTTTACTT TCCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 5070707..5070998 | 210..501 | 1460 | 100 | Plus |
chr2L | 23010047 | chr2L | 5070326..5070456 | 82..212 | 655 | 100 | Plus |
chr2L | 23010047 | chr2L | 5070203..5070258 | 28..83 | 280 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-A | 13424 | TART-A 13424bp | 360..493 | 284..150 | 132 | 61.4 | Minus |
TART-A | 13424 | TART-A 13424bp | 11538..11671 | 284..150 | 132 | 61.4 | Minus |
R1A1-element | 5356 | R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). | 894..927 | 290..323 | 107 | 79.4 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 5070104..5070130 | 1..27 | 96 | -> | Plus |
chr2L | 5070203..5070257 | 28..82 | 100 | -> | Plus |
chr2L | 5070327..5070455 | 83..211 | 100 | -> | Plus |
chr2L | 5070709..5070998 | 212..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RB | 1..279 | 80..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RA | 1..279 | 80..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RC | 1..279 | 80..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RB | 1..279 | 80..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RC | 1..279 | 80..358 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RA | 2..502 | 1..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RC | 48..548 | 1..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RC | 48..548 | 1..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RA | 2..502 | 1..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL37A-RC | 48..548 | 1..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5071004..5071030 | 1..27 | 96 | -> | Plus |
2L | 5071103..5071157 | 28..82 | 100 | -> | Plus |
2L | 5071227..5071355 | 83..211 | 100 | -> | Plus |
2L | 5071609..5071898 | 212..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5071004..5071030 | 1..27 | 96 | -> | Plus |
2L | 5071103..5071157 | 28..82 | 100 | -> | Plus |
2L | 5071227..5071355 | 83..211 | 100 | -> | Plus |
2L | 5071609..5071898 | 212..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5071004..5071030 | 1..27 | 96 | -> | Plus |
2L | 5071103..5071157 | 28..82 | 100 | -> | Plus |
2L | 5071227..5071355 | 83..211 | 100 | -> | Plus |
2L | 5071609..5071898 | 212..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 5071227..5071355 | 83..211 | 100 | -> | Plus |
arm_2L | 5071004..5071030 | 1..27 | 96 | -> | Plus |
arm_2L | 5071103..5071157 | 28..82 | 100 | -> | Plus |
arm_2L | 5071609..5071898 | 212..503 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 5071609..5071898 | 212..503 | 99 | Plus | |
2L | 5071004..5071030 | 1..27 | 96 | -> | Plus |
2L | 5071103..5071157 | 28..82 | 100 | -> | Plus |
2L | 5071227..5071355 | 83..211 | 100 | -> | Plus |
Translation from 79 to 357
> RE23595.hyp MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQ*
Translation from 79 to 357
> RE23595.pep MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQ*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14155-PA | 133 | GF14155-PA | 42..133 | 1..92 | 471 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG25050-PA | 92 | GG25050-PA | 1..92 | 1..92 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10266-PA | 92 | GH10266-PA | 1..92 | 1..92 | 454 | 97.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL37A-PA | 92 | CG5827-PA | 1..92 | 1..92 | 478 | 100 | Plus |
RpL37A-PB | 92 | CG5827-PB | 1..92 | 1..92 | 478 | 100 | Plus |
RpL37A-PC | 92 | CG5827-PC | 1..92 | 1..92 | 478 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI15627-PA | 92 | GI15627-PA | 1..92 | 1..92 | 459 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL19320-PA | 92 | GL19320-PA | 1..92 | 1..92 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA19160-PA | 92 | GA19160-PA | 1..92 | 1..92 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM18527-PA | 92 | GM18527-PA | 1..92 | 1..92 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD12023-PA | 92 | GD12023-PA | 1..92 | 1..92 | 462 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ17297-PA | 92 | GJ17297-PA | 1..92 | 1..92 | 459 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK23946-PA | 92 | GK23946-PA | 1..92 | 1..92 | 459 | 98.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11334-PA | 92 | GE11334-PA | 1..92 | 1..92 | 462 | 100 | Plus |