Clone RE23595 Report

Search the DGRC for RE23595

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:235
Well:95
Vector:pFlc-1
Associated Gene/TranscriptRpL37A-RA
Protein status:RE23595.pep: gold
Sequenced Size:519

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG5827 2001-12-14 Blastp of sequenced clone
CG5827 2002-01-01 Sim4 clustering to Release 2
CG5827 2003-01-01 Sim4 clustering to Release 3
RpL37A 2008-04-29 Release 5.5 accounting
RpL37A 2008-08-15 Release 5.9 accounting
RpL37A 2008-12-18 5.12 accounting

Clone Sequence Records

RE23595.complete Sequence

519 bp (519 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071189

> RE23595.complete
CTTTTTTCGATTTTTCGTTTCCGGCGTAATACTGCTGGCGAATCTTTCCC
GTGTCTAACACACCAACAACAACAGCAAAATGGCCAAGCGCACCAAGAAG
GTTGGAATCGTTGGTAAATATGGTACCCGTTATGGTGCCTCCCTGCGTAA
GATGGTCAAGAAGATGGAAATCACCCAGCACAGCAAGTACACTTGCTCCT
TCTGCGGCAAGGACTCCATGAAGCGCGCCGTTGTGGGCATCTGGTCCTGC
AAGCGCTGCAAAAGGACCGTCGCCGGTGGCGCCTGGGTGTACTCCACCAC
CGCCGCCGCCTCCGTGCGATCCGCCGTCCGTCGTCTGCGTGAAACCAAGG
AACAGTAAACATAAACGGATCATTAATGATGGAACCATCTAATTGAATGC
TCCGCTATGCTAGCTCCCGTAGTTTTAATCTGACAACGCGATTTTCCTGT
GGTTTGCGCCGTGCCGGTCATGTGAAAATAAAAAAAAATGTTTTTTACTT
TCCAAAAAAAAAAAAAAAA

RE23595.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
DmL37a-RA 869 DmL37a-RA 96..593 4..501 2490 100 Plus
DmL37a-RB 857 DmL37a-RB 96..569 28..501 2370 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:39:25
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 5070707..5070998 210..501 1460 100 Plus
chr2L 23010047 chr2L 5070326..5070456 82..212 655 100 Plus
chr2L 23010047 chr2L 5070203..5070258 28..83 280 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5071607..5071898 210..501 1460 100 Plus
2L 23513712 2L 5071226..5071356 82..212 655 100 Plus
2L 23513712 2L 5071103..5071158 28..83 280 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:14
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5071607..5071898 210..501 1460 100 Plus
2L 23513712 2L 5071226..5071356 82..212 655 100 Plus
2L 23513712 2L 5071103..5071158 28..83 280 100 Plus
Blast to na_te.dros performed 2019-03-15 19:39:23
Subject Length Description Subject Range Query Range Score Percent Strand
TART-A 13424 TART-A 13424bp 360..493 284..150 132 61.4 Minus
TART-A 13424 TART-A 13424bp 11538..11671 284..150 132 61.4 Minus
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 894..927 290..323 107 79.4 Plus

RE23595.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:40:20 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 5070104..5070130 1..27 96 -> Plus
chr2L 5070203..5070257 28..82 100 -> Plus
chr2L 5070327..5070455 83..211 100 -> Plus
chr2L 5070709..5070998 212..503 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:21 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RB 1..279 80..358 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:47 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RA 1..279 80..358 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:35 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 1..279 80..358 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:23 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RB 1..279 80..358 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:03 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 1..279 80..358 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:20 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RA 2..502 1..503 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:47 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 48..548 1..503 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:35 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 48..548 1..503 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:23 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RA 2..502 1..503 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:03 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
RpL37A-RC 48..548 1..503 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:20 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5071004..5071030 1..27 96 -> Plus
2L 5071103..5071157 28..82 100 -> Plus
2L 5071227..5071355 83..211 100 -> Plus
2L 5071609..5071898 212..503 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:20 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5071004..5071030 1..27 96 -> Plus
2L 5071103..5071157 28..82 100 -> Plus
2L 5071227..5071355 83..211 100 -> Plus
2L 5071609..5071898 212..503 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:40:20 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5071004..5071030 1..27 96 -> Plus
2L 5071103..5071157 28..82 100 -> Plus
2L 5071227..5071355 83..211 100 -> Plus
2L 5071609..5071898 212..503 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:35 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5071227..5071355 83..211 100 -> Plus
arm_2L 5071004..5071030 1..27 96 -> Plus
arm_2L 5071103..5071157 28..82 100 -> Plus
arm_2L 5071609..5071898 212..503 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:21 Download gff for RE23595.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5071609..5071898 212..503 99   Plus
2L 5071004..5071030 1..27 96 -> Plus
2L 5071103..5071157 28..82 100 -> Plus
2L 5071227..5071355 83..211 100 -> Plus

RE23595.hyp Sequence

Translation from 79 to 357

> RE23595.hyp
MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA
VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQ*

RE23595.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:02:29
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-PA 92 CG5827-PA 1..92 1..92 478 100 Plus
RpL37A-PB 92 CG5827-PB 1..92 1..92 478 100 Plus
RpL37A-PC 92 CG5827-PC 1..92 1..92 478 100 Plus

RE23595.pep Sequence

Translation from 79 to 357

> RE23595.pep
MAKRTKKVGIVGKYGTRYGASLRKMVKKMEITQHSKYTCSFCGKDSMKRA
VVGIWSCKRCKRTVAGGAWVYSTTAAASVRSAVRRLRETKEQ*

RE23595.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14155-PA 133 GF14155-PA 42..133 1..92 471 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25050-PA 92 GG25050-PA 1..92 1..92 462 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:29:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10266-PA 92 GH10266-PA 1..92 1..92 454 97.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:51
Subject Length Description Subject Range Query Range Score Percent Strand
RpL37A-PA 92 CG5827-PA 1..92 1..92 478 100 Plus
RpL37A-PB 92 CG5827-PB 1..92 1..92 478 100 Plus
RpL37A-PC 92 CG5827-PC 1..92 1..92 478 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI15627-PA 92 GI15627-PA 1..92 1..92 459 98.9 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL19320-PA 92 GL19320-PA 1..92 1..92 462 100 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19160-PA 92 GA19160-PA 1..92 1..92 462 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18527-PA 92 GM18527-PA 1..92 1..92 462 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:29:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD12023-PA 92 GD12023-PA 1..92 1..92 462 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ17297-PA 92 GJ17297-PA 1..92 1..92 459 98.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23946-PA 92 GK23946-PA 1..92 1..92 459 98.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:29:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11334-PA 92 GE11334-PA 1..92 1..92 462 100 Plus