Clone RE23851 Report

Search the DGRC for RE23851

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:238
Well:51
Vector:pFlc-1
Associated Gene/TranscriptCG11560-RA
Protein status:RE23851.pep: gold
Sequenced Size:1162

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11560 2008-12-18 5.12 accounting

Clone Sequence Records

RE23851.complete Sequence

1162 bp assembled on 2008-10-23

GenBank Submission: BT050548.1

> RE23851.complete
GTTCTTAATTTTTTTTACTATGACCATAAGGATTGCGAGGCGAAATATGT
TTTTCATACACGCCCCCGAGGAGGAGAAGTGCATGGAGGCGCAGCTGGAC
ATCCTTATGAAGATCAACTCCGGTGAATATCGGCTGGTGAAGAAGAACAA
GCGCAGTTCCGTTTGGAACGTCTACCGGGAAATCGCTCGTCCGGACGGCA
CCAAGTTGAAATGGCGATACTTCTGCATGGGCTGCAAGCGTGTGATGCAG
AGCACCGGCGGCACCACCTCCAATCTGCGCATCCACAAGTGCCACGTACG
GTATATCAAGCAGAACGGCCATCTCACCGACGGCAGTCACTCCTACGACC
ATGATCCCGCGCCACCAGCTAGCCAACCGTCGCCGCGCGTCCAGAAACCG
AAGACCAGGCGGCCGACATCCTATTCTACGCAGTGTGAGCAGTTCTATGA
GGTCACCATGGATCCGGAGACCCAGTACAGCGATCTGGATGATGAGATTG
AGGCTTCTTTGGAGGAGGAGCAGACTCTGAAATCAAAACGTGAATTGGAA
TCCTCCCACTCCAGACCCCTGCTGAAGCTCTTCTCCGAGGAGAACTTGTC
GACTGAACCAGAGGAGCCGGAAGACGAGATTGAGATTGTGGAGGCGGAAG
ATCAGGTGCCCATCGAGCTGGACCTATGTGACATCCAACATACTACATCC
GATGCTGGCGGTGAGGCAATCGAACCCAAGCCAACGGAAAGTGTCGCCCA
GTTCGATGCCAATGCCATTTCCGAAGCGGAATCCTATGCCAAAGCCTGGG
CTCACGCCTTCCTGCGGCTGAACGAGGACCAAAAGTTCTACGCCAAGCGC
TCCATAGATGAACTACTGGTCTTGGGTCGTCTGGAGCGACTGAGCATTTC
CACGGTCACATCCTTGACCACAAACCTGTAGCACCTCACCATGCCAATAC
CGCATATGTAAATTAGCTTAAGAATTTATTTATATTGCAGACTCAATGAT
TTGCTCACTTAACGTAGATCCCCAATAAATAAATAATAAAAATTAGAATA
AATATATAAAATAATATATTCGATAGCGATTTAAGTAAACATTTATAAAC
TACACTTTAGTTTAGAATTTACACAAATAAACAATACCAAAAAGCCAAAA
AAAAAAAAAAAA

RE23851.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 21:10:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-RA 1192 CG11560-RA 45..1188 1..1144 5705 99.9 Plus
CG11560.a 1185 CG11560.a 568..1185 527..1144 3090 100 Plus
CG11560.a 1185 CG11560.a 30..555 1..526 2615 99.8 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 15:01:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 12111408..12112025 527..1144 3090 100 Plus
chr3L 24539361 chr3L 12110816..12111341 1..526 2615 99.8 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 15:01:21
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 12120655..12121272 527..1144 3090 100 Plus
3L 28110227 3L 12120063..12120588 1..526 2615 99.8 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:28:46
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 12113755..12114372 527..1144 3090 100 Plus
3L 28103327 3L 12113163..12113688 1..526 2615 99.8 Plus
Blast to na_te.dros performed 2019-03-15 15:01:22
Subject Length Description Subject Range Query Range Score Percent Strand
Transpac 5249 Transpac 5249bp Derived from AF222049 (AF222049.1) (Rel. 62, Last updated, Version 1). 3550..3670 966..1087 147 63.2 Plus
412 7567 412 412 7567bp 6792..6905 1028..1137 145 64.7 Plus
Dbuz\BuT5 669 Dbuz\BuT5 BUT5 669bp 263..328 1126..1062 111 65.2 Minus

RE23851.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 15:02:02 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 12110816..12111341 1..526 99 -> Plus
chr3L 12111408..12112025 527..1146 92   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:33 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..912 20..931 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 21:15:48 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..912 20..931 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:58:45 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..912 20..931 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:23:11 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..912 20..931 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 07:55:09 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..1060 1..1060 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 21:15:48 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..1060 1..1060 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:58:45 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 45..1101 1..1057 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-10-23 16:08:02 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 1..1060 1..1060 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:23:11 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
CG11560-RA 45..1101 1..1057 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:02:02 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12120063..12120588 1..526 99 -> Plus
3L 12120655..12121272 527..1146 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:02:02 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12120063..12120588 1..526 99 -> Plus
3L 12120655..12121272 527..1146 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 15:02:02 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12120063..12120588 1..526 99 -> Plus
3L 12120655..12121272 527..1146 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:58:45 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 12113163..12113688 1..526 99 -> Plus
arm_3L 12113755..12114372 527..1146 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:46:42 Download gff for RE23851.complete
Subject Subject Range Query Range Percent Splice Strand
3L 12113163..12113688 1..526 99 -> Plus
3L 12113755..12114372 527..1146 99   Plus

RE23851.hyp Sequence

Translation from 0 to 930

> RE23851.hyp
FLIFFTMTIRIARRNMFFIHAPEEEKCMEAQLDILMKINSGEYRLVKKNK
RSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLRIHKCHVR
YIKQNGHLTDGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQFYE
VTMDPETQYSDLDDEIEASLEEEQTLKSKRELESSHSRPLLKLFSEENLS
TEPEEPEDEIEIVEAEDQVPIELDLCDIQHTTSDAGGEAIEPKPTESVAQ
FDANAISEAESYAKAWAHAFLRLNEDQKFYAKRSIDELLVLGRLERLSIS
TVTSLTTNL*

RE23851.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:09:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-PA 303 CG11560-PA 1..303 7..309 1581 100 Plus
ssp-PA 368 CG17153-PA 14..86 29..103 210 54.7 Plus
CG34116-PA 211 CG34116-PA 7..123 33..128 184 36.8 Plus
CG34116-PA 211 CG34116-PA 99..207 201..302 162 33.9 Plus

RE23851.pep Sequence

Translation from 1 to 930

> RE23851.pep
FLIFFTMTIRIARRNMFFIHAPEEEKCMEAQLDILMKINSGEYRLVKKNK
RSSVWNVYREIARPDGTKLKWRYFCMGCKRVMQSTGGTTSNLRIHKCHVR
YIKQNGHLTDGSHSYDHDPAPPASQPSPRVQKPKTRRPTSYSTQCEQFYE
VTMDPETQYSDLDDEIEASLEEEQTLKSKRELESSHSRPLLKLFSEENLS
TEPEEPEDEIEIVEAEDQVPIELDLCDIQHTTSDAGGEAIEPKPTESVAQ
FDANAISEAESYAKAWAHAFLRLNEDQKFYAKRSIDELLVLGRLERLSIS
TVTSLTTNL*

RE23851.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 12:11:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF23587-PA 280 GF23587-PA 1..280 16..309 823 57 Plus
Dana\GF20046-PA 338 GF20046-PA 6..77 29..102 230 55.4 Plus
Dana\GF10849-PA 217 GF10849-PA 7..82 33..106 193 47.4 Plus
Dana\GF10849-PA 217 GF10849-PA 163..214 252..303 167 55.8 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 12:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15558-PA 299 GG15558-PA 1..299 7..309 1266 82.6 Plus
Dere\GG15557-PA 367 GG15557-PA 13..94 28..111 225 51.2 Plus
Dere\GG13372-PA 213 GG13372-PA 7..80 33..104 193 47.3 Plus
Dere\GG13372-PA 213 GG13372-PA 142..209 235..302 166 47.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 12:11:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14652-PA 313 GH14652-PA 1..313 16..309 696 50.2 Plus
Dgri\GH16915-PA 252 GH16915-PA 7..83 33..107 183 45.5 Plus
Dgri\GH16915-PA 252 GH16915-PA 193..251 251..306 158 52.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:18:15
Subject Length Description Subject Range Query Range Score Percent Strand
CG11560-PA 303 CG11560-PA 1..303 7..309 1581 100 Plus
CG11560-PB 307 CG11560-PB 1..307 7..309 1566 98.7 Plus
ssp-PA 368 CG17153-PA 14..86 29..103 210 54.7 Plus
CG34116-PA 211 CG34116-PA 7..123 33..128 184 36.8 Plus
CG34116-PA 211 CG34116-PA 99..207 201..302 162 33.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 12:11:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11637-PA 274 GI11637-PA 1..274 16..309 736 55.7 Plus
Dmoj\GI13669-PA 153 GI13669-PA 84..152 242..306 153 43.5 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 12:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15729-PA 290 GL15729-PA 1..290 16..309 772 54.4 Plus
Dper\GL15728-PA 391 GL15728-PA 23..97 29..103 257 57.3 Plus
Dper\GL15680-PA 121 GL15680-PA 66..117 251..302 153 51.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 12:11:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA23781-PA 290 GA23781-PA 1..290 16..309 772 54.1 Plus
Dpse\GA23780-PA 378 GA23780-PA 19..93 29..103 256 57.3 Plus
Dpse\GA23501-PA 123 GA23501-PA 68..119 251..302 151 51.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 12:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25326-PA 298 GM25326-PA 1..298 7..309 1437 89.4 Plus
Dsec\GM25325-PA 368 GM25325-PA 19..86 34..103 220 57.1 Plus
Dsec\GM16254-PA 211 GM16254-PA 7..82 33..106 191 46.1 Plus
Dsec\GM16254-PA 211 GM16254-PA 147..207 242..302 155 45.9 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 12:11:52
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14356-PA 298 GD14356-PA 1..298 7..309 1459 90.8 Plus
Dsim\GD12250-PA 211 GD12250-PA 7..82 33..106 192 46.1 Plus
Dsim\GD12250-PA 211 GD12250-PA 156..207 251..302 159 51.9 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 12:11:53
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ11319-PA 281 GJ11319-PA 1..281 16..309 734 55.1 Plus
Dvir\GJ14005-PA 256 GJ14005-PA 7..255 33..306 292 30.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 12:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK16966-PA 344 GK16966-PA 1..344 16..309 669 44.5 Plus
Dwil\GK16703-PA 264 GK16703-PA 7..87 33..111 186 44.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 12:11:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21882-PA 305 GE21882-PA 1..305 7..309 1332 84.3 Plus
Dyak\GE21881-PA 368 GE21881-PA 19..86 34..103 216 55.7 Plus
Dyak\GE22465-PA 213 GE22465-PA 7..80 33..104 193 47.3 Plus
Dyak\GE22465-PA 213 GE22465-PA 139..209 232..302 166 45.1 Plus
Dyak\GE14589-PA 101 GE14589-PA 46..97 251..302 164 53.8 Plus