Clone RE23864 Report

Search the DGRC for RE23864

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:238
Well:64
Vector:pFlc-1
Associated Gene/Transcriptl(2)k12914-RA
Protein status:RE23864.pep: gold
Preliminary Size:339
Sequenced Size:541

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13393 2002-01-01 Sim4 clustering to Release 2
CG13393 2002-04-21 Blastp of sequenced clone
CG13393 2003-01-01 Sim4 clustering to Release 3
CG13393 2008-04-29 Release 5.5 accounting
CG13393 2008-08-15 Release 5.9 accounting
CG13393 2008-12-18 5.12 accounting

Clone Sequence Records

RE23864.complete Sequence

541 bp (541 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113429

> RE23864.complete
AAAACTAGACGAACGGTCCTACTTTTGAGTTCTCTCCCAATTTGTGACGT
GTCTGCGATTAATTTGTTAAAAAGCGCCTTTATCCTTAAATATCCGGACA
AATATCACATAAAATAGCAAAATGGTGGAGCTGTCGAGCGTCATTTCCAA
GTTCTACAACGACTACGTGCAGAATACGCCCAAGAAACTGAAGCTGGTGG
ACATCTACCTCGGCTACATTCTGCTCACCGGCATCATCCAGTTTGTTTAC
TGCTGCCTGGTTGGAACCTTCCCGTTCAACTCCTTCCTATCTGGTTTCAT
CAGCACCGTCAGCTGTTTCGTCCTGGCAGTGTGCCTACGCCTGCAGGCCA
ATCCCCAGAACAAGAGCGTGTTTGCCGGCATTTCGCCGGAACGCGGTTTC
GCCGACTTCATCTTCGCTCATGTGATCCTTCATCTGGTGGTCATGAACTT
CATCGGTTAACAAAGCTACAAACATTCTGATATTCTCGGATATATTTATA
AATAAAATGTAACTCTAATTGTAACAAAAAAAAAAAAAAAA

RE23864.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG13393-RA 522 CG13393-RA 1..522 2..523 2610 100 Plus
CG13393.a 459 CG13393.a 1..239 2..240 1195 100 Plus
CG13393.a 459 CG13393.a 233..459 297..523 1105 99.1 Plus
Rcd4-RA 833 Rcd4-RA 787..833 523..477 235 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:50:07
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 8382522..8383043 523..2 2610 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:50:05
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8383611..8384132 523..2 2610 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 8383611..8384132 523..2 2610 100 Minus
Blast to na_te.dros performed 2019-03-16 12:50:06
Subject Length Description Subject Range Query Range Score Percent Strand
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6529..6561 524..491 113 85.3 Minus

RE23864.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:51:11 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 8382520..8383043 1..525 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:35 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..339 122..460 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:52 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..339 122..460 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 11:39:27 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k12914-RA 1..339 122..460 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:10 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..339 122..460 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:57:26 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k12914-RA 1..339 122..460 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:43 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..522 2..523 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:52 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..521 2..522 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 11:39:27 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k12914-RA 5..526 1..522 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:11 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
CG13393-RA 1..522 2..523 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:57:26 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
l(2)k12914-RA 5..526 1..522 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:11 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8383609..8384132 1..525 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:11 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8383609..8384132 1..525 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:51:11 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8383609..8384132 1..525 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 11:39:27 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 8383609..8384132 1..525 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:19 Download gff for RE23864.complete
Subject Subject Range Query Range Percent Splice Strand
2L 8383609..8384132 1..525 99   Minus

RE23864.hyp Sequence

Translation from 121 to 459

> RE23864.hyp
MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTF
PFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAH
VILHLVVMNFIG*

RE23864.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:07:06
Subject Length Description Subject Range Query Range Score Percent Strand
l(2)k12914-PA 112 CG13393-PA 1..112 1..112 578 100 Plus

RE23864.pep Sequence

Translation from 121 to 459

> RE23864.pep
MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTF
PFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAH
VILHLVVMNFIG*

RE23864.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 01:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF14682-PA 112 GF14682-PA 1..112 1..112 572 98.2 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:38:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG23447-PA 112 GG23447-PA 1..112 1..112 576 100 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 01:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH23638-PA 112 GH23638-PA 1..112 1..112 550 93.8 Plus
Dgri\GH11354-PA 112 GH11354-PA 1..112 1..112 550 93.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:29:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dad1-PA 112 CG13393-PA 1..112 1..112 578 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 01:38:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12966-PA 112 GI12966-PA 1..112 1..112 544 94.6 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 01:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL25808-PA 113 GL25808-PA 2..113 1..112 537 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 01:38:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA12252-PA 113 GA12252-PA 2..113 1..112 537 92.9 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM12988-PA 112 GM12988-PA 1..112 1..112 576 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:38:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22410-PA 112 GD22410-PA 1..112 1..112 576 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 01:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18193-PA 112 GJ18193-PA 1..112 1..112 560 97.3 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 01:38:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24842-PA 112 GK24842-PA 1..112 1..112 561 95.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:38:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11027-PA 112 GE11027-PA 1..112 1..112 576 100 Plus