BDGP Sequence Production Resources |
Search the DGRC for RE23864
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 238 |
Well: | 64 |
Vector: | pFlc-1 |
Associated Gene/Transcript | l(2)k12914-RA |
Protein status: | RE23864.pep: gold |
Preliminary Size: | 339 |
Sequenced Size: | 541 |
Gene | Date | Evidence |
---|---|---|
CG13393 | 2002-01-01 | Sim4 clustering to Release 2 |
CG13393 | 2002-04-21 | Blastp of sequenced clone |
CG13393 | 2003-01-01 | Sim4 clustering to Release 3 |
CG13393 | 2008-04-29 | Release 5.5 accounting |
CG13393 | 2008-08-15 | Release 5.9 accounting |
CG13393 | 2008-12-18 | 5.12 accounting |
541 bp (541 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113429
> RE23864.complete AAAACTAGACGAACGGTCCTACTTTTGAGTTCTCTCCCAATTTGTGACGT GTCTGCGATTAATTTGTTAAAAAGCGCCTTTATCCTTAAATATCCGGACA AATATCACATAAAATAGCAAAATGGTGGAGCTGTCGAGCGTCATTTCCAA GTTCTACAACGACTACGTGCAGAATACGCCCAAGAAACTGAAGCTGGTGG ACATCTACCTCGGCTACATTCTGCTCACCGGCATCATCCAGTTTGTTTAC TGCTGCCTGGTTGGAACCTTCCCGTTCAACTCCTTCCTATCTGGTTTCAT CAGCACCGTCAGCTGTTTCGTCCTGGCAGTGTGCCTACGCCTGCAGGCCA ATCCCCAGAACAAGAGCGTGTTTGCCGGCATTTCGCCGGAACGCGGTTTC GCCGACTTCATCTTCGCTCATGTGATCCTTCATCTGGTGGTCATGAACTT CATCGGTTAACAAAGCTACAAACATTCTGATATTCTCGGATATATTTATA AATAAAATGTAACTCTAATTGTAACAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG13393-RA | 522 | CG13393-RA | 1..522 | 2..523 | 2610 | 100 | Plus |
CG13393.a | 459 | CG13393.a | 1..239 | 2..240 | 1195 | 100 | Plus |
CG13393.a | 459 | CG13393.a | 233..459 | 297..523 | 1105 | 99.1 | Plus |
Rcd4-RA | 833 | Rcd4-RA | 787..833 | 523..477 | 235 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2L | 23010047 | chr2L | 8382522..8383043 | 523..2 | 2610 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8383611..8384132 | 523..2 | 2610 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 8383611..8384132 | 523..2 | 2610 | 100 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Quasimodo | 7387 | Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. | 6529..6561 | 524..491 | 113 | 85.3 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 8382520..8383043 | 1..525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..339 | 122..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..339 | 122..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)k12914-RA | 1..339 | 122..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..339 | 122..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)k12914-RA | 1..339 | 122..460 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..522 | 2..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..521 | 2..522 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)k12914-RA | 5..526 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG13393-RA | 1..522 | 2..523 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(2)k12914-RA | 5..526 | 1..522 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8383609..8384132 | 1..525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8383609..8384132 | 1..525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8383609..8384132 | 1..525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 8383609..8384132 | 1..525 | 99 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 8383609..8384132 | 1..525 | 99 | Minus |
Translation from 121 to 459
> RE23864.hyp MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTF PFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAH VILHLVVMNFIG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(2)k12914-PA | 112 | CG13393-PA | 1..112 | 1..112 | 578 | 100 | Plus |
Translation from 121 to 459
> RE23864.pep MVELSSVISKFYNDYVQNTPKKLKLVDIYLGYILLTGIIQFVYCCLVGTF PFNSFLSGFISTVSCFVLAVCLRLQANPQNKSVFAGISPERGFADFIFAH VILHLVVMNFIG*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF14682-PA | 112 | GF14682-PA | 1..112 | 1..112 | 572 | 98.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG23447-PA | 112 | GG23447-PA | 1..112 | 1..112 | 576 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH23638-PA | 112 | GH23638-PA | 1..112 | 1..112 | 550 | 93.8 | Plus |
Dgri\GH11354-PA | 112 | GH11354-PA | 1..112 | 1..112 | 550 | 93.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dad1-PA | 112 | CG13393-PA | 1..112 | 1..112 | 578 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI12966-PA | 112 | GI12966-PA | 1..112 | 1..112 | 544 | 94.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL25808-PA | 113 | GL25808-PA | 2..113 | 1..112 | 537 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA12252-PA | 113 | GA12252-PA | 2..113 | 1..112 | 537 | 92.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM12988-PA | 112 | GM12988-PA | 1..112 | 1..112 | 576 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD22410-PA | 112 | GD22410-PA | 1..112 | 1..112 | 576 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18193-PA | 112 | GJ18193-PA | 1..112 | 1..112 | 560 | 97.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24842-PA | 112 | GK24842-PA | 1..112 | 1..112 | 561 | 95.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE11027-PA | 112 | GE11027-PA | 1..112 | 1..112 | 576 | 100 | Plus |