Clone RE24163 Report

Search the DGRC for RE24163

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:241
Well:63
Vector:pFlc-1
Associated Gene/TranscriptCG17361-RA
Protein status:RE24163.pep: gold
Preliminary Size:561
Sequenced Size:893

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG17361 2001-12-14 Blastp of sequenced clone
CG17361 2002-01-01 Sim4 clustering to Release 2
CG17361 2003-01-01 Sim4 clustering to Release 3
CG17361 2008-04-29 Release 5.5 accounting
CG17361 2008-08-15 Release 5.9 accounting
CG17361 2008-12-18 5.12 accounting

Clone Sequence Records

RE24163.complete Sequence

893 bp (893 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071193

> RE24163.complete
CTGTTTTGGCTTGATGGTCATCCGATACAGTTTAGTTATTCTTTTTGAAT
TGTATTTGCTTGGAATCGAAGGAAGCAACGAAGCCATGGATGAATTGGTG
AAGATGTGCCGGGTGTGTATGGACGAGCCGAAGGACCTGCTAGACATCTA
CGACAACAAGAGCTTGGGGGACAGACTGAGCGACGATCTACAGCGAACCA
AGGAACCGGAGCCCACGCCGGCTGATTTGCTGAATATCTGCAGCGCATAT
CCAGTGGATACCGGGGACGGCTTTCCGCTGAAAATTTGCGAACCGTGCCT
TATTAAATTGCGTGAGGCCTTGAGATTCAGGAGACGCTACACAAGGACCA
TGGAATACGTGGCGCGCGTGAAGAGGGAGCAAAGCGACAAGGAGACATGC
GATCTCCTGGAGGCCGAGGATTGGGATTTTACGGATCGCATCAAGAGCGA
GGAGGAGGAGGAGGAGGACGATGGGGACCGGAACGATAAGCAGCCGAAGA
AGGAGACTCGCAACGAGGTGGATAAGAGGCGGCCCTTCAAATGCACCGAC
TGCCAAAAAAGTTTCACCGGCAAGGCCCAGTTGACCATGCACAGGCGCAC
CCACACCAAAGGATCCACAAGGACCAGACGAAAAGCTCTTAAATAGTCCT
TGGCAACGCTTGGCAAAATGTAGCCAACTAAAATAGTAATTAATCATCTT
GTATCATCGTTTTAAAAATAAGTTCGATATATTTTTAAAGTAGAAACAAG
TTAGCGACTAATAATGAAAGTACATATGGAGTGTAGTTTTAAAACAATTT
CATGTTCTCATATTGACAATAAGATAATAAAGAAATGATAATCGGATCGA
TTCACAACAGTTAAAAAAAATTTTTTTAAAAAAAAAAAAAAAA

RE24163.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:40:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG17361-RA 868 CG17361-RA 1..863 1..862 4275 99.8 Plus
CG17359-RA 1356 CG17359-RA 1192..1356 862..699 785 99.3 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:28:31
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 13987253..13988115 1..862 4235 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:37 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13997193..13998055 1..862 4265 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:07:48
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 13990293..13991155 1..862 4275 99.8 Plus
Blast to na_te.dros performed 2019-03-16 19:28:29
Subject Length Description Subject Range Query Range Score Percent Strand
TART-C 11124 TART-C TARTC 11124bp 11022..11109 714..797 114 63.6 Plus

RE24163.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:37 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 13987253..13988120 1..867 97   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:43 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..633 14..646 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:05:34 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..633 14..646 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..633 14..646 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:30:10 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..633 14..646 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:05 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..633 14..646 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:33:29 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..868 1..867 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:05:34 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..868 1..867 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:14 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 3..865 1..862 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:30:10 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 1..868 1..867 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:05 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
CG17361-RA 3..865 1..862 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:37 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13997193..13998060 1..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:37 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13997193..13998060 1..867 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:37 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13997193..13998060 1..867 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:14 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13990293..13991160 1..867 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:06:22 Download gff for RE24163.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13990293..13991160 1..867 99   Plus

RE24163.hyp Sequence

Translation from 0 to 645

> RE24163.hyp
CFGLMVIRYSLVILFELYLLGIEGSNEAMDELVKMCRVCMDEPKDLLDIY
DNKSLGDRLSDDLQRTKEPEPTPADLLNICSAYPVDTGDGFPLKICEPCL
IKLREALRFRRRYTRTMEYVARVKREQSDKETCDLLEAEDWDFTDRIKSE
EEEEEDDGDRNDKQPKKETRNEVDKRRPFKCTDCQKSFTGKAQLTMHRRT
HTKGSTRTRRKALK*

RE24163.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:08:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG17361-PA 210 CG17361-PA 1..210 5..214 1111 100 Plus
CG15436-PA 346 CG15436-PA 1..153 32..206 190 27.4 Plus
CG17359-PA 339 CG17359-PA 2..101 31..133 146 34.9 Plus

RE24163.pep Sequence

Translation from 13 to 645

> RE24163.pep
MVIRYSLVILFELYLLGIEGSNEAMDELVKMCRVCMDEPKDLLDIYDNKS
LGDRLSDDLQRTKEPEPTPADLLNICSAYPVDTGDGFPLKICEPCLIKLR
EALRFRRRYTRTMEYVARVKREQSDKETCDLLEAEDWDFTDRIKSEEEEE
EDDGDRNDKQPKKETRNEVDKRRPFKCTDCQKSFTGKAQLTMHRRTHTKG
STRTRRKALK*

RE24163.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:39:01
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF24056-PA 198 GF24056-PA 1..197 25..210 391 44.9 Plus
Dana\GF21288-PA 199 GF21288-PA 16..139 70..198 144 30.3 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:39:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15665-PA 182 GG15665-PA 1..182 25..210 739 76.3 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH10681-PA 355 GH10681-PA 4..188 31..198 162 25.9 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:41:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17361-PA 210 CG17361-PA 1..210 1..210 1111 100 Plus
CG15436-PA 346 CG15436-PA 1..153 28..202 190 27.4 Plus
CG17359-PA 339 CG17359-PA 2..101 27..129 146 34.9 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:39:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI11127-PA 384 GI11127-PA 1..203 25..198 156 25.9 Plus
Dmoj\GI17073-PA 439 GI17073-PA 7..178 30..198 147 31.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:39:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17956-PA 244 GL17956-PA 1..229 25..199 217 29.6 Plus
Dper\GL22218-PA 159 GL22218-PA 1..117 25..146 201 38.2 Plus
Dper\GL20492-PA 419 GL20492-PA 1..153 28..198 198 33.1 Plus
Dper\GL20556-PA 429 GL20556-PA 1..153 28..198 194 32.6 Plus
Dper\GL26891-PA 236 GL26891-PA 3..167 30..198 161 25.8 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14480-PA 244 GA14480-PA 1..229 25..199 217 29.6 Plus
Dpse\GA27423-PA 152 GA27423-PA 1..99 25..128 186 40 Plus
Dpse\GA22449-PA 245 GA22449-PA 1..155 28..202 160 28.7 Plus
Dpse\GA24802-PA 245 GA24802-PA 1..152 28..199 156 28 Plus
Dpse\GA28105-PA 389 GA28105-PA 60..211 8..198 155 27.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:39:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25443-PA 185 GM25443-PA 1..185 25..210 767 84.9 Plus
Dsec\GM18478-PA 345 GM18478-PA 1..152 28..202 153 26.7 Plus
Dsec\GM24566-PA 343 GM24566-PA 2..100 27..129 151 36.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14470-PA 284 GD14470-PA 1..116 31..146 566 93.1 Plus
Dsim\GD12639-PA 127 GD12639-PA 2..100 27..129 147 35.8 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:39:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12300-PA 260 GJ12300-PA 3..165 30..198 220 32.6 Plus
Dvir\GJ11368-PA 438 GJ11368-PA 3..109 30..143 170 35.3 Plus
Dvir\GJ11385-PA 430 GJ11385-PA 4..160 31..198 165 29.2 Plus
Dvir\GJ17144-PA 321 GJ17144-PA 5..153 41..198 159 33.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:39:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21993-PA 182 GE21993-PA 1..182 25..210 698 74.7 Plus
Dyak\GE18294-PA 346 GE18294-PA 4..175 31..198 194 27 Plus
Dyak\GE18295-PA 346 GE18295-PA 1..153 28..202 168 23.9 Plus
Dyak\GE13173-PA 192 GE13173-PA 4..162 31..198 156 26.9 Plus