BDGP Sequence Production Resources |
Search the DGRC for RE24163
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 241 |
Well: | 63 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG17361-RA |
Protein status: | RE24163.pep: gold |
Preliminary Size: | 561 |
Sequenced Size: | 893 |
Gene | Date | Evidence |
---|---|---|
CG17361 | 2001-12-14 | Blastp of sequenced clone |
CG17361 | 2002-01-01 | Sim4 clustering to Release 2 |
CG17361 | 2003-01-01 | Sim4 clustering to Release 3 |
CG17361 | 2008-04-29 | Release 5.5 accounting |
CG17361 | 2008-08-15 | Release 5.9 accounting |
CG17361 | 2008-12-18 | 5.12 accounting |
893 bp (893 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071193
> RE24163.complete CTGTTTTGGCTTGATGGTCATCCGATACAGTTTAGTTATTCTTTTTGAAT TGTATTTGCTTGGAATCGAAGGAAGCAACGAAGCCATGGATGAATTGGTG AAGATGTGCCGGGTGTGTATGGACGAGCCGAAGGACCTGCTAGACATCTA CGACAACAAGAGCTTGGGGGACAGACTGAGCGACGATCTACAGCGAACCA AGGAACCGGAGCCCACGCCGGCTGATTTGCTGAATATCTGCAGCGCATAT CCAGTGGATACCGGGGACGGCTTTCCGCTGAAAATTTGCGAACCGTGCCT TATTAAATTGCGTGAGGCCTTGAGATTCAGGAGACGCTACACAAGGACCA TGGAATACGTGGCGCGCGTGAAGAGGGAGCAAAGCGACAAGGAGACATGC GATCTCCTGGAGGCCGAGGATTGGGATTTTACGGATCGCATCAAGAGCGA GGAGGAGGAGGAGGAGGACGATGGGGACCGGAACGATAAGCAGCCGAAGA AGGAGACTCGCAACGAGGTGGATAAGAGGCGGCCCTTCAAATGCACCGAC TGCCAAAAAAGTTTCACCGGCAAGGCCCAGTTGACCATGCACAGGCGCAC CCACACCAAAGGATCCACAAGGACCAGACGAAAAGCTCTTAAATAGTCCT TGGCAACGCTTGGCAAAATGTAGCCAACTAAAATAGTAATTAATCATCTT GTATCATCGTTTTAAAAATAAGTTCGATATATTTTTAAAGTAGAAACAAG TTAGCGACTAATAATGAAAGTACATATGGAGTGTAGTTTTAAAACAATTT CATGTTCTCATATTGACAATAAGATAATAAAGAAATGATAATCGGATCGA TTCACAACAGTTAAAAAAAATTTTTTTAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr3L | 24539361 | chr3L | 13987253..13988115 | 1..862 | 4235 | 99.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28110227 | 3L | 13997193..13998055 | 1..862 | 4265 | 99.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
3L | 28103327 | 3L | 13990293..13991155 | 1..862 | 4275 | 99.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
TART-C | 11124 | TART-C TARTC 11124bp | 11022..11109 | 714..797 | 114 | 63.6 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr3L | 13987253..13988120 | 1..867 | 97 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..633 | 14..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..633 | 14..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..633 | 14..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..633 | 14..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..633 | 14..646 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..868 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..868 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 3..865 | 1..862 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 1..868 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG17361-RA | 3..865 | 1..862 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13997193..13998060 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13997193..13998060 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13997193..13998060 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_3L | 13990293..13991160 | 1..867 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
3L | 13990293..13991160 | 1..867 | 99 | Plus |
Translation from 0 to 645
> RE24163.hyp CFGLMVIRYSLVILFELYLLGIEGSNEAMDELVKMCRVCMDEPKDLLDIY DNKSLGDRLSDDLQRTKEPEPTPADLLNICSAYPVDTGDGFPLKICEPCL IKLREALRFRRRYTRTMEYVARVKREQSDKETCDLLEAEDWDFTDRIKSE EEEEEDDGDRNDKQPKKETRNEVDKRRPFKCTDCQKSFTGKAQLTMHRRT HTKGSTRTRRKALK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17361-PA | 210 | CG17361-PA | 1..210 | 5..214 | 1111 | 100 | Plus |
CG15436-PA | 346 | CG15436-PA | 1..153 | 32..206 | 190 | 27.4 | Plus |
CG17359-PA | 339 | CG17359-PA | 2..101 | 31..133 | 146 | 34.9 | Plus |
Translation from 13 to 645
> RE24163.pep MVIRYSLVILFELYLLGIEGSNEAMDELVKMCRVCMDEPKDLLDIYDNKS LGDRLSDDLQRTKEPEPTPADLLNICSAYPVDTGDGFPLKICEPCLIKLR EALRFRRRYTRTMEYVARVKREQSDKETCDLLEAEDWDFTDRIKSEEEEE EDDGDRNDKQPKKETRNEVDKRRPFKCTDCQKSFTGKAQLTMHRRTHTKG STRTRRKALK*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF24056-PA | 198 | GF24056-PA | 1..197 | 25..210 | 391 | 44.9 | Plus |
Dana\GF21288-PA | 199 | GF21288-PA | 16..139 | 70..198 | 144 | 30.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG15665-PA | 182 | GG15665-PA | 1..182 | 25..210 | 739 | 76.3 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH10681-PA | 355 | GH10681-PA | 4..188 | 31..198 | 162 | 25.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG17361-PA | 210 | CG17361-PA | 1..210 | 1..210 | 1111 | 100 | Plus |
CG15436-PA | 346 | CG15436-PA | 1..153 | 28..202 | 190 | 27.4 | Plus |
CG17359-PA | 339 | CG17359-PA | 2..101 | 27..129 | 146 | 34.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI11127-PA | 384 | GI11127-PA | 1..203 | 25..198 | 156 | 25.9 | Plus |
Dmoj\GI17073-PA | 439 | GI17073-PA | 7..178 | 30..198 | 147 | 31.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL17956-PA | 244 | GL17956-PA | 1..229 | 25..199 | 217 | 29.6 | Plus |
Dper\GL22218-PA | 159 | GL22218-PA | 1..117 | 25..146 | 201 | 38.2 | Plus |
Dper\GL20492-PA | 419 | GL20492-PA | 1..153 | 28..198 | 198 | 33.1 | Plus |
Dper\GL20556-PA | 429 | GL20556-PA | 1..153 | 28..198 | 194 | 32.6 | Plus |
Dper\GL26891-PA | 236 | GL26891-PA | 3..167 | 30..198 | 161 | 25.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14480-PA | 244 | GA14480-PA | 1..229 | 25..199 | 217 | 29.6 | Plus |
Dpse\GA27423-PA | 152 | GA27423-PA | 1..99 | 25..128 | 186 | 40 | Plus |
Dpse\GA22449-PA | 245 | GA22449-PA | 1..155 | 28..202 | 160 | 28.7 | Plus |
Dpse\GA24802-PA | 245 | GA24802-PA | 1..152 | 28..199 | 156 | 28 | Plus |
Dpse\GA28105-PA | 389 | GA28105-PA | 60..211 | 8..198 | 155 | 27.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM25443-PA | 185 | GM25443-PA | 1..185 | 25..210 | 767 | 84.9 | Plus |
Dsec\GM18478-PA | 345 | GM18478-PA | 1..152 | 28..202 | 153 | 26.7 | Plus |
Dsec\GM24566-PA | 343 | GM24566-PA | 2..100 | 27..129 | 151 | 36.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD14470-PA | 284 | GD14470-PA | 1..116 | 31..146 | 566 | 93.1 | Plus |
Dsim\GD12639-PA | 127 | GD12639-PA | 2..100 | 27..129 | 147 | 35.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ12300-PA | 260 | GJ12300-PA | 3..165 | 30..198 | 220 | 32.6 | Plus |
Dvir\GJ11368-PA | 438 | GJ11368-PA | 3..109 | 30..143 | 170 | 35.3 | Plus |
Dvir\GJ11385-PA | 430 | GJ11385-PA | 4..160 | 31..198 | 165 | 29.2 | Plus |
Dvir\GJ17144-PA | 321 | GJ17144-PA | 5..153 | 41..198 | 159 | 33.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE21993-PA | 182 | GE21993-PA | 1..182 | 25..210 | 698 | 74.7 | Plus |
Dyak\GE18294-PA | 346 | GE18294-PA | 4..175 | 31..198 | 194 | 27 | Plus |
Dyak\GE18295-PA | 346 | GE18295-PA | 1..153 | 28..202 | 168 | 23.9 | Plus |
Dyak\GE13173-PA | 192 | GE13173-PA | 4..162 | 31..198 | 156 | 26.9 | Plus |