Clone RE24409 Report

Search the DGRC for RE24409

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:244
Well:9
Vector:pFlc-1
Associated Gene/TranscriptMf-RB
Protein status:RE24409.pep: gold
Sequenced Size:1654

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG6803 2001-12-14 Blastp of sequenced clone
CG6803 2002-01-01 Sim4 clustering to Release 2
Zeelin1 2008-04-29 Release 5.5 accounting
Mf 2008-08-15 Release 5.9 accounting
Mf 2008-12-18 5.12 accounting

Clone Sequence Records

RE24409.complete Sequence

1654 bp (1654 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071198

> RE24409.complete
TGGCAGTTTGAAAAAATTCTTCGTTGAGGATAGATCGCTATTTTTTAGGA
GTAAATTTAAATTCGAACGAGTTCAACGATTTTTTCGTGAACAGAACAAA
ACAAATCGATCAAAATGTTCAAAAACCACTTGGAAATGATTGGGCGCAAT
GAGAGCCCCAGCAAGAAGGCGAAATTCTGGCAGTCCTACATCAGGTCCCT
GAAGGGCTCCGAGGATATCCGTGCCCACGAGGCGCCCCGTGCCTCTCGTC
CCTACAGCTCCTACCTGGACTCGCCCTCCTACAGGAGCATCTATGACGAG
CCCGCCACCGCCAATGAGCGCGTCCAGTCCTCTGGCTACAGATATCTGCC
AGTGAGCCGCGACACCTACGGCTACTCGCCCCGTGCCATCTACGATCATC
ACTACAGCCGAACAATTCCAGCTAACTACGACGCAGAGAAGGCCTGGAAT
GATCATCTGAAGCGCATGCAGGAGATCGAGCGCAGGTACCCATCTCGCTA
TGGTCTCTACTTGAGGGACAAGCCACTCACGCCCAACTCGCTGGTGCCCC
TGGAGTACGAGCCAGAGGACAAGCTGCTGGCTGAGCTCAACAAGGCTCGT
CGCTCGGCCTCGCCGTTCCGCCCTGCCAGGACGACCCGTGCCGGCAGCGA
GCCGTACGTGCCACCGCCGAGCTACTGGAACCGCGAGGGCAGCGTGCCAC
GCGGAGGACCCTCGGTCTTCGATCGTGCCACCAGCTTGGCCCCGTTCACG
CGGCCCAGCTTCCGTGCCAGCTCCCTGGAGCCGCTGGACGAACTCTTTGA
ACGTAAGTTGCCCGCGATCGCCGAGGCTGATTCGGCGCCAGCTGATGCGC
CCAGTCGGCCACTCGGTATCTTTGAGCGCGCCGGTTCGCCAAGTCCCACT
CCCGTGAAAGCCGGTCGCTGGGGACCCCGTCCCACCGAAGTCGCCTACGA
TGCTGAGGGACTCCCCATCTTTCACCCACGCAACCGCTTCAGGGATCTGC
TGAGCCCCAGCCCCAACTTGCCGATCTCCTCGATTGTGCGCGATCCCTTC
TGGTGGGACGTGGATGACCTGGTGCCCTTCCGCGCCACCTCGGTGCCCCG
TGCCTCGAGCCCCGTAGCCCGGGATTCGTACTTGTCGCCGGTGAAGAACC
GCTACTTGTGGTCCAAGCACCCAGCTAGACCCTTGACACCTGAGGAAGAG
GATTTATTCTAAACAAATTATATAGATTCAAAATCACAAACAATCGTTTA
GCTCTAATAACAAAGCGACGCTATACAAATCATATAGCAGTTCTGTAATT
TTTTTGTACTTAATTTTACATAAATTACACGTAACGAAACGTAAAAAAAA
AAACAAATTGCTCACCGCTCAATTTTGTAAACGAACGAAACAACGAACTA
CACACCAACTAAATAACATCCTGAAGAACTAAAACAACGAATGCATCACA
CAAGGGGCCCCCAAAACAATGACAACCTGCTTTGGAGTAGATCAGTAGCA
AAAGGCTTTGCAAGTCTTAATATCCGTGAAAAACGTTTGAATTTTTTCAA
AACTGCAAGAACTCCCCTCGGAACGAGAAAACAACCATCACTTTCGTCTG
GGGTTCTCAAAATATTTGCCAAGAAGTGCGTAATTCCCAAAAAAAAAAAA
AAAA

RE24409.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:50
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-RB 2336 Mf-RB 228..1878 3..1653 8195 99.7 Plus
Mf.e 2192 Mf.e 241..1041 3..803 4005 100 Plus
Mf-RJ 1992 Mf-RJ 38..838 3..803 4005 100 Plus
Mf.e 2192 Mf.e 1041..1735 959..1653 3415 99.4 Plus
Mf-RJ 1992 Mf-RJ 838..1532 959..1653 3415 99.4 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 03:18:39
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 10998609..10998973 959..595 1810 99.7 Minus
chr3R 27901430 chr3R 10995726..10996004 1638..1360 1395 100 Minus
chr3R 27901430 chr3R 10997229..10997460 1189..958 1145 99.6 Minus
chr3R 27901430 chr3R 11002908..11003118 415..205 1055 100 Minus
chr3R 27901430 chr3R 10996565..10996739 1360..1186 860 99.4 Minus
chr3R 27901430 chr3R 11003666..11003808 206..64 700 99.3 Minus
chr3R 27901430 chr3R 11000813..11000924 595..484 560 100 Minus
chr3R 27901430 chr3R 11000991..11001066 487..412 365 98.7 Minus
chr3R 27901430 chr3R 11004836..11004896 63..3 305 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:48 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 03:18:37
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15173980..15174344 959..595 1825 100 Minus
3R 32079331 3R 15171082..15171375 1653..1360 1425 99 Minus
3R 32079331 3R 15172600..15172831 1189..958 1145 99.6 Minus
3R 32079331 3R 15178280..15178490 415..205 1055 100 Minus
3R 32079331 3R 15171936..15172110 1360..1186 860 99.4 Minus
3R 32079331 3R 15179038..15179180 206..64 715 100 Minus
3R 32079331 3R 15176184..15176295 595..484 560 100 Minus
3R 32079331 3R 15176362..15176437 487..412 365 98.7 Minus
3R 32079331 3R 15180208..15180268 63..3 305 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:21
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 14914811..14915175 959..595 1825 100 Minus
3R 31820162 3R 14911913..14912206 1653..1360 1425 98.9 Minus
3R 31820162 3R 14913431..14913662 1189..958 1145 99.5 Minus
3R 31820162 3R 14919111..14919321 415..205 1055 100 Minus
3R 31820162 3R 14912767..14912941 1360..1186 860 99.4 Minus
3R 31820162 3R 14919869..14920011 206..64 715 100 Minus
3R 31820162 3R 14917015..14917126 595..484 560 100 Minus
3R 31820162 3R 14917193..14917268 487..412 365 98.6 Minus
3R 31820162 3R 14921039..14921099 63..3 305 100 Minus
Blast to na_te.dros performed on 2019-03-16 03:18:38 has no hits.

RE24409.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 03:19:40 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 10996565..10996735 1190..1360 100 <- Minus
chr3R 10995726..10996003 1361..1638 100 <- Minus
chr3R 10997229..10997459 959..1189 99 <- Minus
chr3R 10998610..10998972 596..958 99 <- Minus
chr3R 11000813..11000922 486..595 100 <- Minus
chr3R 11000993..11001062 416..485 100 <- Minus
chr3R 11002908..11003117 206..415 100 <- Minus
chr3R 11003667..11003808 64..205 99 <- Minus
chr3R 11004836..11004897 1..63 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:54 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1098 115..1212 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:01 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1098 115..1212 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:43:55 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1098 115..1212 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:10 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1098 115..1212 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 05:34:53 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1098 115..1212 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:06 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1638 1..1638 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:01 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1638 1..1638 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:43:55 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1638 1..1638 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:10 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1638 1..1638 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 05:34:53 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
Mf-RB 1..1638 1..1638 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:40 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15176184..15176293 486..595 100 <- Minus
3R 15176364..15176433 416..485 100 <- Minus
3R 15178280..15178489 206..415 100 <- Minus
3R 15179039..15179180 64..205 100 <- Minus
3R 15180208..15180269 1..63 98   Minus
3R 15171097..15171374 1361..1638 100 <- Minus
3R 15171936..15172106 1190..1360 100 <- Minus
3R 15172600..15172830 959..1189 99 <- Minus
3R 15173981..15174343 596..958 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:40 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15176184..15176293 486..595 100 <- Minus
3R 15176364..15176433 416..485 100 <- Minus
3R 15178280..15178489 206..415 100 <- Minus
3R 15179039..15179180 64..205 100 <- Minus
3R 15180208..15180269 1..63 98   Minus
3R 15171097..15171374 1361..1638 100 <- Minus
3R 15171936..15172106 1190..1360 100 <- Minus
3R 15172600..15172830 959..1189 99 <- Minus
3R 15173981..15174343 596..958 100 <- Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 03:19:40 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15176184..15176293 486..595 100 <- Minus
3R 15176364..15176433 416..485 100 <- Minus
3R 15178280..15178489 206..415 100 <- Minus
3R 15179039..15179180 64..205 100 <- Minus
3R 15180208..15180269 1..63 98   Minus
3R 15171097..15171374 1361..1638 100 <- Minus
3R 15171936..15172106 1190..1360 100 <- Minus
3R 15172600..15172830 959..1189 99 <- Minus
3R 15173981..15174343 596..958 100 <- Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:43:55 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 10996819..10997096 1361..1638 100 <- Minus
arm_3R 10997658..10997828 1190..1360 100 <- Minus
arm_3R 10998322..10998552 959..1189 99 <- Minus
arm_3R 10999703..11000065 596..958 100 <- Minus
arm_3R 11001906..11002015 486..595 100 <- Minus
arm_3R 11002086..11002155 416..485 100 <- Minus
arm_3R 11004002..11004211 206..415 100 <- Minus
arm_3R 11004761..11004902 64..205 100 <- Minus
arm_3R 11005930..11005991 1..63 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:46 Download gff for RE24409.complete
Subject Subject Range Query Range Percent Splice Strand
3R 14911928..14912205 1361..1638 100 <- Minus
3R 14912767..14912937 1190..1360 100 <- Minus
3R 14913431..14913661 959..1189 99 <- Minus
3R 14914812..14915174 596..958 100 <- Minus
3R 14917015..14917124 486..595 100 <- Minus
3R 14917195..14917264 416..485 100 <- Minus
3R 14919111..14919320 206..415 100 <- Minus
3R 14919870..14920011 64..205 100 <- Minus
3R 14921039..14921100 1..63 98   Minus

RE24409.pep Sequence

Translation from 114 to 1211

> RE24409.pep
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
IPANYDAEKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEP
EDKLLAELNKARRSASPFRPARTTRAGSEPYVPPPSYWNREGSVPRGGPS
VFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADSAPADAPSRPL
GIFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP
NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWS
KHPARPLTPEEEDLF*

RE24409.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17159-PA 370 GF17159-PA 1..370 1..365 1728 92.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:21:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20880-PA 365 GG20880-PA 1..365 1..365 1864 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14549-PA 367 GH14549-PA 1..367 1..365 1670 90.8 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:12:10
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PB 365 CG6803-PB 1..365 1..365 1953 100 Plus
Mf-PM 364 CG6803-PM 1..364 1..364 1923 98.9 Plus
Mf-PL 364 CG6803-PL 1..364 1..364 1923 98.9 Plus
Mf-PJ 313 CG6803-PJ 1..313 1..365 1615 85.8 Plus
Mf-PF 313 CG6803-PF 1..313 1..365 1615 85.8 Plus
Mf-PD 312 CG6803-PD 1..312 1..364 1585 84.6 Plus
Mf-PO 310 CG6803-PO 1..310 1..364 1557 83.8 Plus
Mf-PI 230 CG6803-PI 1..229 1..229 1221 100 Plus
Mf-PH 236 CG6803-PH 1..229 1..229 1221 100 Plus
Mf-PE 166 CG6803-PE 1..164 1..164 869 99.4 Plus
Mf-PQ 168 CG6803-PQ 1..162 1..162 858 98.8 Plus
Mf-PC 168 CG6803-PC 1..162 1..162 858 98.8 Plus
Mf-PN 157 CG6803-PN 1..156 1..163 802 94.5 Plus
Mf-PG 157 CG6803-PG 1..156 1..163 802 94.5 Plus
Mf-PA 157 CG6803-PA 1..156 1..163 802 94.5 Plus
Mf-PP 119 CG6803-PP 1..100 1..100 534 100 Plus
Mf-PK 119 CG6803-PK 1..100 1..100 534 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:21:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI23663-PA 367 GI23663-PA 1..367 1..365 1725 92.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:21:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21688-PA 367 GL21688-PA 1..367 1..365 1708 92.9 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA19873-PB 367 GA19873-PB 1..367 1..365 1710 93.2 Plus
Dpse\GA19873-PA 313 GA19873-PA 1..313 1..365 1491 82.2 Plus
Dpse\GA19873-PC 312 GA19873-PC 1..312 1..364 1473 81.9 Plus
Dpse\GA19873-PD 168 GA19873-PD 1..162 1..162 825 96.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:21:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25804-PA 367 GM25804-PA 1..367 1..364 1825 98.1 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD20380-PA 236 GD20380-PA 1..229 1..229 1179 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:21:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23223-PA 363 GJ23223-PA 1..363 1..365 1708 94 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:21:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13979-PA 368 GK13979-PA 1..368 1..365 1670 91.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:21:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE26409-PA 313 GE26409-PA 1..313 1..365 1537 84.9 Plus

RE24409.hyp Sequence

Translation from 114 to 1211

> RE24409.hyp
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
IPANYDAEKAWNDHLKRMQEIERRYPSRYGLYLRDKPLTPNSLVPLEYEP
EDKLLAELNKARRSASPFRPARTTRAGSEPYVPPPSYWNREGSVPRGGPS
VFDRATSLAPFTRPSFRASSLEPLDELFERKLPAIAEADSAPADAPSRPL
GIFERAGSPSPTPVKAGRWGPRPTEVAYDAEGLPIFHPRNRFRDLLSPSP
NLPISSIVRDPFWWDVDDLVPFRATSVPRASSPVARDSYLSPVKNRYLWS
KHPARPLTPEEEDLF*

RE24409.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:30:43
Subject Length Description Subject Range Query Range Score Percent Strand
Mf-PB 365 CG6803-PB 1..365 1..365 1953 100 Plus
Mf-PM 364 CG6803-PM 1..364 1..364 1923 98.9 Plus
Mf-PL 364 CG6803-PL 1..364 1..364 1923 98.9 Plus
Mf-PJ 313 CG6803-PJ 1..313 1..365 1615 85.8 Plus
Mf-PF 313 CG6803-PF 1..313 1..365 1615 85.8 Plus