Clone RE24422 Report

Search the DGRC for RE24422

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:244
Well:22
Vector:pFlc-1
Associated Gene/TranscriptCG11076-RB
Protein status:RE24422.pep: wuzgold
Preliminary Size:840
Sequenced Size:1150

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11076 2001-12-14 Blastp of sequenced clone
CG11076 2002-01-01 Sim4 clustering to Release 2
CG11076 2003-01-01 Sim4 clustering to Release 3
CG11076 2008-04-29 Release 5.5 accounting
CG11076 2008-08-15 Release 5.9 accounting
CG11076 2008-12-18 5.12 accounting

Clone Sequence Records

RE24422.complete Sequence

1150 bp (1150 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071199

> RE24422.complete
ACTGACGACTGATACACCCATGAAAAGGTGGTTTAATGGATTGCAAGCTG
ATGTGGCTGAGTAGAGGAGGAAAAACCTCGGAGCCAATTTCTGGAGGAGG
AACAGTACGTGAACCTGACCTCAGGCGCGGCTGCTCGTGAGTGCTGCGGG
GATGCTCTTTGGGATTTCGATGGTCAGACCGACGAAGCCTGGCTGGTCCA
GTGTCCCAAGGGTGCAGATCCACATCTGCTAGTCGGCAAGCGCATTAGGC
TTCCTGGCAGGAAGAGCGTGGGCGATCTCCAGGTTCGTGCCGTCAAAAAC
TCGACGTTACAGAGCGAGGCACTGGGCTATTTGAGATCTATGGGTCCCTA
TGCCCTCCGGAAAATTCCCTTTGTCGGCTATGTGGTAATCAGCAAGCGTC
TATATGATAAACAACCGCTACCAGGTCAGAAGGAACATACAATTCAAGCT
GATCTAACGCTACCCAAGTACCTATTACGAGAACGACATCCGTTGTTCGG
GCGCAGCTACAAGCAACGCATCCAATTACCGAAGATGATTTCCACATCTC
TTAGTCAAGCAGACGAGAAATTCTTGGAAGCTACTGCCAAGCTTCGCAGC
ACTGCTAACTACTACAAGATCCGGAGCAAGCTGCACACCACCACACAGAC
GCTAGAACAAAAAGAGGACGATGTGCGACAGTCGGTGCTTACCGGTCGTA
CGCCGCAGTTCATGAAGGAAACAATAATCCCGGATCTATATAAAGATCTC
TTAGACGAAGAGGACATCGAGAAAAATATAATGAACCCAGCAGAGGAAGT
TGGTCCTGCCAAAATGCGCAAGAAAAAATTTAATTCAAACGGTCACAAAA
CGGGAAATGCAGTAGGGAAATAGACAAAAGAAGCTTAAATTAAATGAAAG
CAACGGCCGCTAATGACCTGGACGAAGTAATTGCACAAGAAGGCTTAAAA
AAGTCGAATGGAAACCATTAAGAATTAGAGTTTACTTAAGATAAATTCAC
ATACTTACGTAATTAAATAAAAATATGTAACGATTTGGATTATAGATTAT
CACATATAAGCTGCATAAATTAATGTAGTCATTTAATAACGAAATAAAAT
TGCACTTTGTCAAGGCGTGTTCACAGCACTATGGAAAAAAAAAAAAAAAA

RE24422.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG11076-RB 1162 CG11076-RB 1..1133 1..1133 5650 99.9 Plus
CG11076-RA 1261 CG11076-RA 193..1261 65..1133 5345 100 Plus
ATPsyn-beta.f 1039 ATPsyn-beta.f 111..177 67..1 320 98.5 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:54:23
Subject Length Description Subject Range Query Range Score Percent Strand
chr4 1351717 chr4 1050225..1051293 1133..65 5345 100 Minus
chr4 1351717 chr4 1052108..1052174 67..1 320 98.5 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:52 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1029711..1030779 1133..65 5345 100 Minus
4 1348131 4 1031594..1031660 67..1 320 98.5 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:25
Subject Length Description Subject Range Query Range Score Percent Strand
4 1331231 4 1029711..1030779 1133..65 5345 100 Minus
4 1331231 4 1031594..1031660 67..1 320 98.5 Minus
Blast to na_te.dros performed 2019-03-16 12:54:21
Subject Length Description Subject Range Query Range Score Percent Strand
G3 4605 G3 G3 4605bp 4482..4590 998..1104 115 60.9 Plus

RE24422.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:55:12 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
chr4 1050224..1051291 67..1134 99 <- Minus
chr4 1052109..1052174 1..66 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:03:58 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RA 32..840 65..873 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:13:07 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RA 32..840 65..873 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:37:18 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RA 32..840 65..873 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:16 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RA 32..840 65..873 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:07:18 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RA 32..840 65..873 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:44:15 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RB 1..1133 1..1134 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:13:07 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RB 1..1133 1..1133 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:37:18 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RC 98..1230 1..1133 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:16 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RB 1..1133 1..1134 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:07:18 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
CG11076-RE 98..1230 1..1133 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:12 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
4 1029710..1030777 67..1134 99 <- Minus
4 1031595..1031660 1..66 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:12 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
4 1029710..1030777 67..1134 99 <- Minus
4 1031595..1031660 1..66 98   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:55:12 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
4 1029710..1030777 67..1134 99 <- Minus
4 1031595..1031660 1..66 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:37:18 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1050336..1051403 67..1134 99 <- Minus
arm_4 1052221..1052286 1..66 98   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:53 Download gff for RE24422.complete
Subject Subject Range Query Range Percent Splice Strand
4 1029710..1030777 67..1134 99 <- Minus
4 1031595..1031660 1..66 98   Minus

RE24422.pep Sequence

Translation from 339 to 872

> RE24422.pep
MGPYALRKIPFVGYVVISKRLYDKQPLPGQKEHTIQADLTLPKYLLRERH
PLFGRSYKQRIQLPKMISTSLSQADEKFLEATAKLRSTANYYKIRSKLHT
TTQTLEQKEDDVRQSVLTGRTPQFMKETIIPDLYKDLLDEEDIEKNIMNP
AEEVGPAKMRKKKFNSNGHKTGNAVGK*

RE24422.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF20924-PA 328 GF20924-PA 104..268 2..169 372 50 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16423-PA 298 GG16423-PA 105..274 2..173 632 73.8 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH14702-PA 312 GH14702-PA 124..258 4..139 282 45.6 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11076-PE 260 CG11076-PE 84..260 1..177 911 100 Plus
CG11076-PD 260 CG11076-PD 84..260 1..177 911 100 Plus
CG11076-PA 279 CG11076-PA 103..279 1..177 911 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21658-PA 386 GI21658-PA 125..282 2..158 324 45.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL16016-PA 312 GL16016-PA 105..228 2..125 318 52.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22816-PA 312 GA22816-PA 105..228 2..125 316 51.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM13014-PA 287 GM13014-PA 101..270 1..170 797 88.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24362-PA 287 GD24362-PA 101..270 1..170 802 89.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ16016-PA 317 GJ16016-PA 121..305 2..168 321 39.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25433-PA 323 GK25433-PA 106..249 2..145 365 55.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:20:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE14492-PA 274 GE14492-PA 102..265 2..172 561 67.8 Plus

RE24422.hyp Sequence

Translation from 339 to 872

> RE24422.hyp
MGPYALRKIPFVGYVVISKRLYDKQPLPGQKEHTIQADLTLPKYLLRERH
PLFGRSYKQRIQLPKMISTSLSQADEKFLEATAKLRSTANYYKIRSKLHT
TTQTLEQKEDDVRQSVLTGRTPQFMKETIIPDLYKDLLDEEDIEKNIMNP
AEEVGPAKMRKKKFNSNGHKTGNAVGK*

RE24422.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:14:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG11076-PE 260 CG11076-PE 84..260 1..177 911 100 Plus
CG11076-PD 260 CG11076-PD 84..260 1..177 911 100 Plus
CG11076-PA 279 CG11076-PA 103..279 1..177 911 100 Plus