Clone RE24439 Report

Search the DGRC for RE24439

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:244
Well:39
Vector:pFlc-1
Associated Gene/TranscriptCG13678-RA
Protein status:RE24439.pep: gold
Preliminary Size:387
Sequenced Size:575

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13678 2002-01-01 Sim4 clustering to Release 2
CG13678 2003-01-01 Sim4 clustering to Release 3
CG13678 2008-04-29 Release 5.5 accounting
CG13678 2008-08-15 Release 5.9 accounting
CG13678 2008-12-18 5.12 accounting

Clone Sequence Records

RE24439.complete Sequence

575 bp (575 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071202

> RE24439.complete
ATCACAAACCAATTGGCCATCTACCAAGTGACAATCCAAAAAGAAAACCA
ATACATCAACATGTTCAAATTCGCTGCTATCTTCTTCGCTGTTGTGGCTG
TGGCTGCTGCCAAGCCTGGAATTTTGGCTCCTCTGGCCGCCGCTCCTCTG
GCCTACACCGCTCCGGCTGTGGTGGGCAGTGCCGCCTACGTGGCTCCCTA
CGCCTCCAGCTACACCGCCCACTCGGTGGCCCACAGCGCCGCCTTCCCAG
CTTCCTATGCCGCTCCAGTTGCCGCCGCCTATACCGCTCCCATTGCTGCT
CCTCTGGCTGCCGCCTACACCGCTCCCTACACCCGATTTGCCACGCCCTA
CGCCGCCGCCTACACCTCGCCCCTGGCCTACAGCTCGCCCTATGTGGCTC
GTCCCTATGTCGCCGCTGCTGCCGCTCCTCTGCTGCTGAAGAAGTAAATC
CATGGATTGTAAACCCTGCGGAAGATATTGCCCCATGAGCTTGGCTCATG
GACTGGCATTTATTTTCCATGCAACCCCTACTTGTGATGCATTAAACCGT
TTAGAATCCAAAAAAAAAAAAAAAA

RE24439.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:45:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13678-RA 600 CG13678-RA 6..563 1..558 2790 100 Plus
CG13679-RA 501 CG13679-RA 99..275 81..257 765 95.4 Plus
CG13679-RB 899 CG13679-RB 432..608 81..257 765 95.4 Plus
CG13679-RA 501 CG13679-RA 352..404 346..398 250 98.1 Plus
CG13679-RB 899 CG13679-RB 685..737 346..398 250 98.1 Plus
CG13679-RA 501 CG13679-RA 393..458 402..467 195 86.3 Plus
CG13679-RB 899 CG13679-RB 726..791 402..467 195 86.3 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 18:59:16
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 8214436..8214921 73..558 2355 99 Plus
chr3L 24539361 chr3L 8194899..8195204 81..398 775 83.6 Plus
chr3L 24539361 chr3L 8210652..8210767 257..142 550 98.3 Minus
chr3L 24539361 chr3L 8214112..8214184 1..73 320 95.9 Plus
chr3L 24539361 chr3L 8210756..8210813 138..81 230 93.1 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:55 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 18:59:14
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 8222467..8222952 73..558 2430 100 Plus
3L 28110227 3L 8202944..8203249 81..398 775 83.6 Plus
3L 28110227 3L 8218671..8218786 257..142 550 98.3 Minus
3L 28110227 3L 8222143..8222215 1..73 365 100 Plus
3L 28110227 3L 8218775..8218832 138..81 230 93.1 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:18
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 8215567..8216052 73..558 2430 100 Plus
3L 28103327 3L 8196044..8196220 81..257 765 95.4 Plus
3L 28103327 3L 8211771..8211886 257..142 550 98.2 Minus
3L 28103327 3L 8215243..8215315 1..73 365 100 Plus
3L 28103327 3L 8196297..8196349 346..398 250 98.1 Plus
3L 28103327 3L 8211875..8211932 138..81 230 93.1 Minus
3L 28103327 3L 8196338..8196403 402..467 195 86.3 Plus
Blast to na_te.dros performed on 2019-03-16 18:59:14 has no hits.

RE24439.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:00:20 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 8214112..8214183 1..72 95 -> Plus
chr3L 8214436..8214921 73..559 98   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:01 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..387 61..447 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:12:56 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..387 61..447 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:21:16 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..387 61..447 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:37:06 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..387 61..447 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 13:57:28 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..387 61..447 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:43:59 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:12:56 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:21:16 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 3..560 1..559 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:37:06 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 1..557 1..557 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 13:57:28 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
CG13678-RA 3..560 1..559 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:20 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8222143..8222214 1..72 100 -> Plus
3L 8222467..8222952 73..559 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:20 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8222143..8222214 1..72 100 -> Plus
3L 8222467..8222952 73..559 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:00:20 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8222143..8222214 1..72 100 -> Plus
3L 8222467..8222952 73..559 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:21:16 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 8215243..8215314 1..72 100 -> Plus
arm_3L 8215567..8216052 73..559 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:14:40 Download gff for RE24439.complete
Subject Subject Range Query Range Percent Splice Strand
3L 8215567..8216052 73..559 99   Plus
3L 8215243..8215314 1..72 100 -> Plus

RE24439.hyp Sequence

Translation from 2 to 487

> RE24439.hyp
HKPIGHLPSDNPKRKPIHQHVQIRCYLLRCCGCGCCQAWNFGSSGRRSSG
LHRSGCGGQCRLRGSLRLQLHRPLGGPQRRLPSFLCRSSCRRLYRSHCCS
SGCRLHRSLHPICHALRRRLHLAPGLQLALCGSSLCRRCCRSSAAEEVNP
WIVNPAEDIAP*
Sequence RE24439.hyp has no blast hits.

RE24439.pep Sequence

Translation from 60 to 446

> RE24439.pep
MFKFAAIFFAVVAVAAAKPGILAPLAAAPLAYTAPAVVGSAAYVAPYASS
YTAHSVAHSAAFPASYAAPVAAAYTAPIAAPLAAAYTAPYTRFATPYAAA
YTSPLAYSSPYVARPYVAAAAAPLLLKK*

RE24439.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF25105-PA 132 GF25105-PA 1..132 1..128 295 76.6 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG14290-PA 129 GG14290-PA 1..129 1..128 520 96.1 Plus
Dere\GG14287-PA 135 GG14287-PA 18..135 18..128 196 74 Plus
Dere\GG15100-PA 522 GG15100-PA 398..439 18..59 143 97.6 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15497-PA 138 GH15497-PA 19..64 18..66 153 76.5 Plus
Dgri\GH15978-PA 157 GH15978-PA 18..59 18..62 142 78.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:06:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG13678-PA 128 CG13678-PA 1..128 1..128 634 100 Plus
CG13679-PB 119 CG13679-PB 2..119 3..128 439 77.1 Plus
CG13674-PB 137 CG13674-PB 2..137 3..128 362 63.7 Plus
CG13674-PA 137 CG13674-PA 2..137 3..128 362 63.7 Plus
CG32214-PC 116 CG32214-PC 1..116 1..126 217 49.2 Plus
CG32214-PB 116 CG32214-PB 1..116 1..126 217 49.2 Plus
825-Oak-PB 129 CG32208-PB 1..129 1..126 212 48.1 Plus
CG32213-PB 129 CG32213-PB 1..129 1..126 212 48.1 Plus
CG14096-PA 122 CG14096-PA 1..122 1..126 207 48.1 Plus
CG12519-PB 131 CG12519-PB 1..131 1..126 205 46.9 Plus
CG12519-PA 131 CG12519-PA 1..131 1..126 205 46.9 Plus
CG13047-PB 170 CG13047-PB 1..160 1..124 196 39.8 Plus
CG18294-PA 141 CG18294-PA 1..141 1..126 190 45.3 Plus
CG13066-PB 93 CG13066-PB 5..88 4..71 187 58.3 Plus
CG13049-PA 181 CG13049-PA 2..134 4..124 182 41 Plus
CG14095-PA 162 CG14095-PA 1..147 1..124 172 36.7 Plus
CG13051-PA 83 CG13051-PA 1..79 1..105 171 49.5 Plus
CG13069-PA 97 CG13069-PA 1..97 1..128 165 42.4 Plus
CG13044-PA 155 CG13044-PA 1..143 1..125 161 38.1 Plus
CG13068-PA 109 CG13068-PA 1..104 1..119 159 46.8 Plus
Vml-PB 578 CG34333-PB 337..445 15..123 157 41.7 Plus
Vml-PA 578 CG34333-PA 337..445 15..123 157 41.7 Plus
Vml-PB 578 CG34333-PB 91..199 15..123 155 41.7 Plus
Vml-PA 578 CG34333-PA 91..199 15..123 155 41.7 Plus
Vml-PB 578 CG34333-PB 115..223 15..123 153 40.9 Plus
Vml-PA 578 CG34333-PA 115..223 15..123 153 40.9 Plus
Vml-PB 578 CG34333-PB 99..215 15..123 152 39.3 Plus
Vml-PB 578 CG34333-PB 361..468 15..123 152 41.7 Plus
Vml-PA 578 CG34333-PA 99..215 15..123 152 39.3 Plus
Vml-PA 578 CG34333-PA 361..468 15..123 152 41.7 Plus
CG13067-PA 79 CG13067-PA 1..78 1..101 149 45.1 Plus
CG11585-PB 342 CG11585-PB 130..254 15..123 148 36 Plus
Vml-PB 578 CG34333-PB 324..429 23..123 147 40.4 Plus
Vml-PA 578 CG34333-PA 324..429 23..123 147 40.4 Plus
CG34205-PA 217 CG34205-PA 27..168 7..125 146 36.5 Plus
Vml-PB 578 CG34333-PB 147..265 15..123 145 40 Plus
Vml-PA 578 CG34333-PA 147..265 15..123 145 40 Plus
Vml-PB 578 CG34333-PB 261..381 15..123 143 36.3 Plus
Vml-PB 578 CG34333-PB 289..405 15..123 143 36.7 Plus
Vml-PA 578 CG34333-PA 261..381 15..123 143 36.3 Plus
Vml-PA 578 CG34333-PA 289..405 15..123 143 36.7 Plus
Cpr64Ad-PB 247 CG1259-PB 16..127 16..124 142 41.7 Plus
CG11350-PC 456 CG11350-PC 74..191 6..123 142 42.1 Plus
CG34205-PA 217 CG34205-PA 83..202 10..127 137 40.6 Plus
CG45069-PB 129 CG45069-PB 16..124 5..115 137 42.2 Plus
CG45069-PA 129 CG45069-PA 16..124 5..115 137 42.2 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI16775-PA 164 GI16775-PA 39..95 1..62 210 79 Plus
Dmoj\GI16628-PA 108 GI16628-PA 2..55 4..62 198 79.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL22540-PA 115 GL22540-PA 1..115 1..128 213 68.2 Plus
Dper\GL22559-PA 127 GL22559-PA 1..116 1..89 166 60.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA24624-PA 115 GA24624-PA 1..115 1..128 199 68.2 Plus
Dpse\GA24666-PA 419 GA24666-PA 310..408 18..89 179 58.8 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM25032-PA 128 GM25032-PA 1..128 1..128 543 98.4 Plus
Dsec\GM25028-PA 127 GM25028-PA 18..127 18..128 207 80.9 Plus
Dsec\GM24957-PA 431 GM24957-PA 307..348 18..59 150 97.6 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD14065-PA 128 GD14065-PA 1..128 1..128 545 99.2 Plus
Dsim\GD14062-PA 127 GD14062-PA 18..127 18..128 209 80 Plus
Dsim\GD13008-PA 423 GD13008-PA 307..348 18..59 150 97.6 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ12519-PA 131 GJ12519-PA 1..131 1..128 187 58.9 Plus
Dvir\GJ12884-PA 170 GJ12884-PA 38..90 5..62 161 82.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK17184-PA 134 GK17184-PA 19..122 18..117 209 67.3 Plus
Dwil\GK17007-PA 140 GK17007-PA 18..106 18..113 209 66.7 Plus
Dwil\GK17005-PA 138 GK17005-PA 18..106 18..113 208 67.7 Plus
Dwil\GK17009-PA 152 GK17009-PA 18..106 18..113 204 67.7 Plus
Dwil\GK17006-PA 138 GK17006-PA 18..106 18..113 203 67.7 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:20:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE20720-PA 136 GE20720-PA 1..136 1..128 274 91.2 Plus
Dyak\GE21324-PA 142 GE21324-PA 18..62 18..62 153 97.8 Plus
Dyak\GE20717-PA 142 GE20717-PA 18..62 18..62 153 97.8 Plus