BDGP Sequence Production Resources |
Search the DGRC for RE24457
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 244 |
Well: | 57 |
Vector: | pFlc-1 |
Associated Gene/Transcript | l(1)G0230-RA |
Protein status: | RE24457.pep: gold |
Sequenced Size: | 680 |
Gene | Date | Evidence |
---|---|---|
CG2968 | 2001-12-14 | Blastp of sequenced clone |
CG2968 | 2002-01-01 | Sim4 clustering to Release 2 |
CG2968 | 2003-01-01 | Sim4 clustering to Release 3 |
l(1)G0230 | 2008-04-29 | Release 5.5 accounting |
l(1)G0230 | 2008-08-15 | Release 5.9 accounting |
l(1)G0230 | 2008-12-18 | 5.12 accounting |
680 bp (680 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071203
> RE24457.complete GTATTCCCGGCTGGTCACTCTGACTTAAACGTTTTTCGCAAAAACAGCGG CTGATCACTGAAGTTTTCTCGTGTTTTTCGCTATCAAACCGAAATAAAAA CAGCCCAAAATGTCCTTCGTTAAGAACGCCCGTTTGCTGGCCGCCCGCGG CGCTCGCTTGGCCCAGAACCGCAGCTACTCGGATGAGATGAAGCTGACCT TCGCCGCCGCCAACAAAACCTTCTACGATGCCGCTGTGGTGCGCCAAATC GATGTGCCTTCCTTCTCGGGATCCTTCGGCATCCTGGCCAAGCACGTGCC CACTCTGGCTGTCCTGAAGCCCGGCGTTGTCCAGGTGGTGGAAAACGATG GCAAGACCCTCAAGTTCTTCGTCTCCAGCGGTTCCGTCACCGTCAACGAG GATTCCTCCGTTCAGGTTCTGGCCGAGGAGGCCCACAACATCGAGGACAT CGATGCCAATGAGGCGCGCCAGCTGCTCGCGAAATACCAGTCACAGCTTA GCTCCGCTGGCGACGACAAGGCCAAGGCCCAGGCTGCCATTGCCGTGGAG GTCGCCGAAGCGTTAGTCAAGGCTGCCGAATAGACGTAATCACCACACAA CCGCCACCAATAAACCACAATCGATGCTTTGTGTCTGAAATAAATAAAAA ACATAACGATCACCAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chrX | 22417052 | chrX | 10105173..10105386 | 308..521 | 1070 | 100 | Plus |
chrX | 22417052 | chrX | 10104892..10105099 | 101..308 | 1025 | 99.5 | Plus |
chrX | 22417052 | chrX | 10105711..10105855 | 519..664 | 680 | 99.3 | Plus |
chrX | 22417052 | chrX | 10104586..10104688 | 1..103 | 515 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23542271 | X | 10213559..10213772 | 308..521 | 1070 | 100 | Plus |
X | 23542271 | X | 10213278..10213485 | 101..308 | 1040 | 100 | Plus |
X | 23542271 | X | 10214097..10214249 | 519..671 | 735 | 98.7 | Plus |
X | 23542271 | X | 10212972..10213074 | 1..103 | 515 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
X | 23527363 | X | 10221657..10221870 | 308..521 | 1070 | 100 | Plus |
X | 23527363 | X | 10221376..10221583 | 101..308 | 1040 | 100 | Plus |
X | 23527363 | X | 10222195..10222347 | 519..671 | 735 | 98.6 | Plus |
X | 23527363 | X | 10221070..10221172 | 1..103 | 515 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chrX | 10104586..10104688 | 1..103 | 100 | -> | Plus |
chrX | 10104895..10105099 | 104..308 | 99 | -> | Plus |
chrX | 10105174..10105385 | 309..520 | 100 | -> | Plus |
chrX | 10105713..10105855 | 521..664 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..474 | 110..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..474 | 110..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..474 | 110..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..474 | 110..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..474 | 110..583 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..663 | 1..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..663 | 1..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 3..666 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 1..663 | 1..663 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
l(1)G0230-RA | 3..666 | 1..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10212972..10213074 | 1..103 | 100 | -> | Plus |
X | 10213281..10213485 | 104..308 | 100 | -> | Plus |
X | 10213560..10213771 | 309..520 | 100 | -> | Plus |
X | 10214099..10214242 | 521..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10212972..10213074 | 1..103 | 100 | -> | Plus |
X | 10213281..10213485 | 104..308 | 100 | -> | Plus |
X | 10213560..10213771 | 309..520 | 100 | -> | Plus |
X | 10214099..10214242 | 521..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10212972..10213074 | 1..103 | 100 | -> | Plus |
X | 10213281..10213485 | 104..308 | 100 | -> | Plus |
X | 10213560..10213771 | 309..520 | 100 | -> | Plus |
X | 10214099..10214242 | 521..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_X | 10107005..10107107 | 1..103 | 100 | -> | Plus |
arm_X | 10107314..10107518 | 104..308 | 100 | -> | Plus |
arm_X | 10107593..10107804 | 309..520 | 100 | -> | Plus |
arm_X | 10108132..10108275 | 521..664 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
X | 10222197..10222340 | 521..664 | 100 | Plus | |
X | 10221379..10221583 | 104..308 | 100 | -> | Plus |
X | 10221658..10221869 | 309..520 | 100 | -> | Plus |
X | 10221070..10221172 | 1..103 | 100 | -> | Plus |
Translation from 109 to 582
> RE24457.pep MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVP SFSGSFGILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSS VQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVEVAE ALVKAAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF19203-PA | 157 | GF19203-PA | 1..157 | 1..157 | 664 | 90.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG18349-PA | 157 | GG18349-PA | 1..157 | 1..157 | 797 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH24459-PA | 157 | GH24459-PA | 1..157 | 1..157 | 664 | 88.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
ATPsyndelta-PC | 157 | CG2968-PC | 1..157 | 1..157 | 756 | 100 | Plus |
ATPsyndelta-PB | 157 | CG2968-PB | 1..157 | 1..157 | 756 | 100 | Plus |
ATPsyndelta-PA | 157 | CG2968-PA | 1..157 | 1..157 | 756 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI14351-PA | 157 | GI14351-PA | 1..157 | 1..157 | 672 | 89.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12886-PA | 157 | GL12886-PA | 1..157 | 1..157 | 683 | 91.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA22488-PA | 157 | GA22488-PA | 1..157 | 1..157 | 683 | 91.1 | Plus |
Dpse\GA28703-PA | 96 | GA28703-PA | 3..96 | 63..157 | 355 | 89.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM11414-PA | 157 | GM11414-PA | 1..157 | 1..157 | 797 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD24697-PA | 168 | GD24697-PA | 1..157 | 1..157 | 797 | 99.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ19398-PA | 157 | GJ19398-PA | 1..157 | 1..157 | 668 | 89.8 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK24980-PA | 160 | GK24980-PA | 1..160 | 1..157 | 678 | 90.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE17838-PA | 157 | GE17838-PA | 1..157 | 1..157 | 796 | 99.4 | Plus |
Translation from 109 to 582
> RE24457.hyp MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVP SFSGSFGILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSS VQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVEVAE ALVKAAE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
l(1)G0230-PC | 157 | CG2968-PC | 1..157 | 1..157 | 756 | 100 | Plus |
l(1)G0230-PB | 157 | CG2968-PB | 1..157 | 1..157 | 756 | 100 | Plus |
l(1)G0230-PA | 157 | CG2968-PA | 1..157 | 1..157 | 756 | 100 | Plus |