Clone RE24457 Report

Search the DGRC for RE24457

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:244
Well:57
Vector:pFlc-1
Associated Gene/Transcriptl(1)G0230-RA
Protein status:RE24457.pep: gold
Sequenced Size:680

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG2968 2001-12-14 Blastp of sequenced clone
CG2968 2002-01-01 Sim4 clustering to Release 2
CG2968 2003-01-01 Sim4 clustering to Release 3
l(1)G0230 2008-04-29 Release 5.5 accounting
l(1)G0230 2008-08-15 Release 5.9 accounting
l(1)G0230 2008-12-18 5.12 accounting

Clone Sequence Records

RE24457.complete Sequence

680 bp (680 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071203

> RE24457.complete
GTATTCCCGGCTGGTCACTCTGACTTAAACGTTTTTCGCAAAAACAGCGG
CTGATCACTGAAGTTTTCTCGTGTTTTTCGCTATCAAACCGAAATAAAAA
CAGCCCAAAATGTCCTTCGTTAAGAACGCCCGTTTGCTGGCCGCCCGCGG
CGCTCGCTTGGCCCAGAACCGCAGCTACTCGGATGAGATGAAGCTGACCT
TCGCCGCCGCCAACAAAACCTTCTACGATGCCGCTGTGGTGCGCCAAATC
GATGTGCCTTCCTTCTCGGGATCCTTCGGCATCCTGGCCAAGCACGTGCC
CACTCTGGCTGTCCTGAAGCCCGGCGTTGTCCAGGTGGTGGAAAACGATG
GCAAGACCCTCAAGTTCTTCGTCTCCAGCGGTTCCGTCACCGTCAACGAG
GATTCCTCCGTTCAGGTTCTGGCCGAGGAGGCCCACAACATCGAGGACAT
CGATGCCAATGAGGCGCGCCAGCTGCTCGCGAAATACCAGTCACAGCTTA
GCTCCGCTGGCGACGACAAGGCCAAGGCCCAGGCTGCCATTGCCGTGGAG
GTCGCCGAAGCGTTAGTCAAGGCTGCCGAATAGACGTAATCACCACACAA
CCGCCACCAATAAACCACAATCGATGCTTTGTGTCTGAAATAAATAAAAA
ACATAACGATCACCAAAAAAAAAAAAAAAA

RE24457.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:26
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-RA 1170 l(1)G0230-RA 39..709 1..671 3325 99.7 Plus
l(1)G0230.a 695 l(1)G0230.a 70..637 104..671 2810 99.6 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 22:47:53
Subject Length Description Subject Range Query Range Score Percent Strand
chrX 22417052 chrX 10105173..10105386 308..521 1070 100 Plus
chrX 22417052 chrX 10104892..10105099 101..308 1025 99.5 Plus
chrX 22417052 chrX 10105711..10105855 519..664 680 99.3 Plus
chrX 22417052 chrX 10104586..10104688 1..103 515 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:43:56 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 22:47:51
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 10213559..10213772 308..521 1070 100 Plus
X 23542271 X 10213278..10213485 101..308 1040 100 Plus
X 23542271 X 10214097..10214249 519..671 735 98.7 Plus
X 23542271 X 10212972..10213074 1..103 515 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:25
Subject Length Description Subject Range Query Range Score Percent Strand
X 23527363 X 10221657..10221870 308..521 1070 100 Plus
X 23527363 X 10221376..10221583 101..308 1040 100 Plus
X 23527363 X 10222195..10222347 519..671 735 98.6 Plus
X 23527363 X 10221070..10221172 1..103 515 100 Plus
Blast to na_te.dros performed on 2019-03-16 22:47:51 has no hits.

RE24457.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 22:48:39 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
chrX 10104586..10104688 1..103 100 -> Plus
chrX 10104895..10105099 104..308 99 -> Plus
chrX 10105174..10105385 309..520 100 -> Plus
chrX 10105713..10105855 521..664 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:02 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 110..583 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:05 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 110..583 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 18:16:29 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 110..583 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:40 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 110..583 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 16:43:11 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..474 110..583 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:43 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:04 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 18:16:29 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 3..666 1..664 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:40 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 1..663 1..663 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 16:43:11 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
l(1)G0230-RA 3..666 1..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:39 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
X 10212972..10213074 1..103 100 -> Plus
X 10213281..10213485 104..308 100 -> Plus
X 10213560..10213771 309..520 100 -> Plus
X 10214099..10214242 521..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:39 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
X 10212972..10213074 1..103 100 -> Plus
X 10213281..10213485 104..308 100 -> Plus
X 10213560..10213771 309..520 100 -> Plus
X 10214099..10214242 521..664 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 22:48:39 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
X 10212972..10213074 1..103 100 -> Plus
X 10213281..10213485 104..308 100 -> Plus
X 10213560..10213771 309..520 100 -> Plus
X 10214099..10214242 521..664 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 18:16:29 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 10107005..10107107 1..103 100 -> Plus
arm_X 10107314..10107518 104..308 100 -> Plus
arm_X 10107593..10107804 309..520 100 -> Plus
arm_X 10108132..10108275 521..664 100   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:44 Download gff for RE24457.complete
Subject Subject Range Query Range Percent Splice Strand
X 10222197..10222340 521..664 100   Plus
X 10221379..10221583 104..308 100 -> Plus
X 10221658..10221869 309..520 100 -> Plus
X 10221070..10221172 1..103 100 -> Plus

RE24457.pep Sequence

Translation from 109 to 582

> RE24457.pep
MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVP
SFSGSFGILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSS
VQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVEVAE
ALVKAAE*

RE24457.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:33:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF19203-PA 157 GF19203-PA 1..157 1..157 664 90.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG18349-PA 157 GG18349-PA 1..157 1..157 797 99.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH24459-PA 157 GH24459-PA 1..157 1..157 664 88.5 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:06:25
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyndelta-PC 157 CG2968-PC 1..157 1..157 756 100 Plus
ATPsyndelta-PB 157 CG2968-PB 1..157 1..157 756 100 Plus
ATPsyndelta-PA 157 CG2968-PA 1..157 1..157 756 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:33:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI14351-PA 157 GI14351-PA 1..157 1..157 672 89.2 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12886-PA 157 GL12886-PA 1..157 1..157 683 91.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:33:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA22488-PA 157 GA22488-PA 1..157 1..157 683 91.1 Plus
Dpse\GA28703-PA 96 GA28703-PA 3..96 63..157 355 89.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM11414-PA 157 GM11414-PA 1..157 1..157 797 99.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:33:09
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD24697-PA 168 GD24697-PA 1..157 1..157 797 99.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ19398-PA 157 GJ19398-PA 1..157 1..157 668 89.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:33:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24980-PA 160 GK24980-PA 1..160 1..157 678 90.6 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:33:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE17838-PA 157 GE17838-PA 1..157 1..157 796 99.4 Plus

RE24457.hyp Sequence

Translation from 109 to 582

> RE24457.hyp
MSFVKNARLLAARGARLAQNRSYSDEMKLTFAAANKTFYDAAVVRQIDVP
SFSGSFGILAKHVPTLAVLKPGVVQVVENDGKTLKFFVSSGSVTVNEDSS
VQVLAEEAHNIEDIDANEARQLLAKYQSQLSSAGDDKAKAQAAIAVEVAE
ALVKAAE*

RE24457.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:21:39
Subject Length Description Subject Range Query Range Score Percent Strand
l(1)G0230-PC 157 CG2968-PC 1..157 1..157 756 100 Plus
l(1)G0230-PB 157 CG2968-PB 1..157 1..157 756 100 Plus
l(1)G0230-PA 157 CG2968-PA 1..157 1..157 756 100 Plus