Clone RE24633 Report

Search the DGRC for RE24633

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:246
Well:33
Vector:pFlc-1
Associated Gene/Transcriptckd-RC
Protein status:RE24633.pep: gold
Sequenced Size:1292

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14959 2004-01-14 Blastp of sequenced clone
CG14959 2008-04-29 Release 5.5 accounting
CG14959 2008-08-15 Release 5.9 accounting
CG14959 2008-12-18 5.12 accounting

Clone Sequence Records

RE24633.complete Sequence

1292 bp (1292 high quality bases) assembled on 2004-01-14

GenBank Submission: BT011465

> RE24633.complete
ATTCGTTCAACGGGCGCTTGAGCGAACGGTTGTTGCTTTGTCTTTTAGCT
TTGGCTTTGTATCTTTGCATCCGACGGATACGCGATTCGATTTGAGCTGT
GCCGCGACTTTGAGTGTGTGTGCGTGTGAAGAAAGAGCTATATTTATATA
TACATATATATATATATAAATATATACATATATAAAATATATTTTGTTGC
CGTTTTCTGGCTGGTGAAATAGCCATAGCAATCCGCCATCGTAATAGCAA
TAGTTTTTCCAGTGTTCATTACATAAAGTATCAACGCCAAAATTTAAATA
TCTCTGTATATACGCATGCCCAGCGAGAAAATCTTATGCAAATGCGTTTT
CAAAAATAATTAAGCGCCAGCCTCGAAATTTGGCAAGAAAGTCGTTTGCA
GTGCCTCAGTGACTTTCTCGGGATTTCTTGGATTCAATTCGAATTTAGTT
TGGATTTCGGATATTTGGATACTCAGCCGCAGTGCAACCTCTAAATCAAG
CCCGCTCCCCGTTTTAGCCATGTGCCGGCCATAAACCGAAGACACGCTTC
CTAATTGAAAACAGAGCCAGCTAAATGGATGCGTAGCAAGAGGCCAGAAG
AGCGAGCGAGAGGGCGAGTGTGTGCGACAGAGAGAGCGAGTGCGAGACGA
TCGTGATTTGGATTTTCAGCGTGATATCAAAACGGAGCGGACAGCAGTCG
AGCGGTCGGTCGAGAAAACAAAACAAAAAAAACAAAAATCACGCCAAAAT
GTTCAACACCACAAAAATGGTTTACAGTTATAGAATTTTATGGCTTTCCG
GCGTTTTACTAGGTCCTATTTTGCTGGCCGCCATTGCGGTTCAAGGCCAA
GAGCCAGCCAGTCCAGTATTTCAAAATCACAAGACGAAGGAATGGACGAA
TTTAGATAATATAACATTCTCATTCGATTGCAAGAGGCGTTCTGTGGGCT
TCTATGCCGACATGGAGTACAATTGCCAGATCTTTCACATGTGCGACGAG
GAGGGCAATCGGATTCCCCATCTGTGCGCCAATGAGACGAGCTTTAACCA
GGAGTACAGAATCTGTGATTGGGACTACAACTTTAACTGCACAGAGTCAC
CCAAATGGTTCTACCTGAACGAACTGACCTATGCCACAGATCCGCCAGAT
GAAGATGACGAGGATTACTGAACGATTTGCACTTAATTAAATATTTATTG
TGTGTCTCCAAAAGCAAACAAACTAATTAAATTAAACGCCGTATGCAAAA
CGCTGAGTAATTGTAACTGAAAGCAGAAAAAAAAAAAAAAAA

RE24633.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:08:18
Subject Length Description Subject Range Query Range Score Percent Strand
ckd.f 1735 ckd.f 58..1349 1..1292 6445 99.9 Plus
ckd.i 1947 ckd.i 270..1561 1..1292 6445 99.9 Plus
ckd-RC 1396 ckd-RC 58..1349 1..1292 6445 99.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:29:09
Subject Length Description Subject Range Query Range Score Percent Strand
chr3L 24539361 chr3L 3257570..3258069 1..500 2500 100 Plus
chr3L 24539361 chr3L 3265826..3266142 498..814 1585 100 Plus
chr3L 24539361 chr3L 3267031..3267203 1103..1275 865 100 Plus
chr3L 24539361 chr3L 3266545..3266713 811..979 845 100 Plus
chr3L 24539361 chr3L 3266844..3266969 977..1102 630 100 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:01 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:07
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3258156..3258655 1..500 2500 100 Plus
3L 28110227 3L 3266400..3266716 498..814 1585 100 Plus
3L 28110227 3L 3267609..3267798 1103..1292 935 99.5 Plus
3L 28110227 3L 3267119..3267287 811..979 845 100 Plus
3L 28110227 3L 3267422..3267547 977..1102 630 100 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 19:53:28
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28103327 3L 3258156..3258655 1..500 2500 100 Plus
3L 28103327 3L 3266400..3266716 498..814 1585 100 Plus
3L 28103327 3L 3267609..3267798 1103..1292 935 99.4 Plus
3L 28103327 3L 3267119..3267287 811..979 845 100 Plus
3L 28103327 3L 3267422..3267547 977..1102 630 100 Plus
Blast to na_te.dros performed on 2019-03-16 19:29:07 has no hits.

RE24633.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:29:53 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
chr3L 3265829..3266140 501..812 100 -> Plus
chr3L 3266547..3266713 813..979 100 -> Plus
chr3L 3266847..3266969 980..1102 100 -> Plus
chr3L 3267031..3267203 1103..1276 99   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:07 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
CG14959-RC 1..423 749..1171 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 16:41:57 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 1..423 749..1171 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:41:33 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 1..423 749..1171 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 17:30:44 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
CG14959-RC 1..423 749..1171 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:33:33 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 1..423 749..1171 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 19:51:27 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
CG14959-RC 2..1251 1..1250 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 16:41:57 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 2..1276 1..1276 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:41:33 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 2..1276 1..1276 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 17:30:44 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
CG14959-RC 2..1251 1..1250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:33:33 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
ckd-RC 2..1276 1..1276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:53 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3258156..3258655 1..500 100 -> Plus
3L 3266403..3266714 501..812 100 -> Plus
3L 3267121..3267287 813..979 100 -> Plus
3L 3267425..3267547 980..1102 100 -> Plus
3L 3267609..3267781 1103..1276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:53 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3258156..3258655 1..500 100 -> Plus
3L 3266403..3266714 501..812 100 -> Plus
3L 3267121..3267287 813..979 100 -> Plus
3L 3267425..3267547 980..1102 100 -> Plus
3L 3267609..3267781 1103..1276 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:29:53 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3258156..3258655 1..500 100 -> Plus
3L 3266403..3266714 501..812 100 -> Plus
3L 3267121..3267287 813..979 100 -> Plus
3L 3267425..3267547 980..1102 100 -> Plus
3L 3267609..3267781 1103..1276 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:41:33 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3258156..3258655 1..500 100 -> Plus
arm_3L 3266403..3266714 501..812 100 -> Plus
arm_3L 3267121..3267287 813..979 100 -> Plus
arm_3L 3267425..3267547 980..1102 100 -> Plus
arm_3L 3267609..3267781 1103..1276 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:03:17 Download gff for RE24633.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3267121..3267287 813..979 100 -> Plus
3L 3267425..3267547 980..1102 100 -> Plus
3L 3267609..3267781 1103..1276 99   Plus
3L 3258156..3258655 1..500 100 -> Plus
3L 3266403..3266714 501..812 100 -> Plus

RE24633.hyp Sequence

Translation from 748 to 1170

> RE24633.hyp
MFNTTKMVYSYRILWLSGVLLGPILLAAIAVQGQEPASPVFQNHKTKEWT
NLDNITFSFDCKRRSVGFYADMEYNCQIFHMCDEEGNRIPHLCANETSFN
QEYRICDWDYNFNCTESPKWFYLNELTYATDPPDEDDEDY*

RE24633.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:41:25
Subject Length Description Subject Range Query Range Score Percent Strand
ckd-PE 140 CG14959-PE 1..140 1..140 789 100 Plus
ckd-PD 140 CG14959-PD 1..140 1..140 789 100 Plus
ckd-PC 140 CG14959-PC 1..140 1..140 789 100 Plus
CG13675-PC 151 CG13675-PC 69..139 58..128 173 42.3 Plus
CG13675-PD 355 CG13675-PD 69..139 58..128 173 42.3 Plus

RE24633.pep Sequence

Translation from 748 to 1170

> RE24633.pep
MFNTTKMVYSYRILWLSGVLLGPILLAAIAVQGQEPASPVFQNHKTKEWT
NLDNITFSFDCKRRSVGFYADMEYNCQIFHMCDEEGNRIPHLCANETSFN
QEYRICDWDYNFNCTESPKWFYLNELTYATDPPDEDDEDY*

RE24633.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:51:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF10125-PA 140 GF10125-PA 1..140 1..140 751 97.9 Plus
Dana\GF16520-PA 620 GF16520-PA 31..127 30..139 177 36.4 Plus
Dana\GF18106-PA 1141 GF18106-PA 866..937 58..128 175 43.1 Plus
Dana\GF17663-PA 1133 GF17663-PA 96..158 58..121 169 45.3 Plus
Dana\GF10477-PA 346 GF10477-PA 79..150 57..128 161 41.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG15117-PA 140 GG15117-PA 1..140 1..140 747 97.9 Plus
Dere\GG20015-PA 641 GG20015-PA 48..129 58..139 175 40.2 Plus
Dere\GG13930-PA 1128 GG13930-PA 96..158 58..121 169 45.3 Plus
Dere\GG20994-PA 1230 GG20994-PA 67..137 58..125 163 44.4 Plus
Dere\GG14914-PA 280 GG14914-PA 25..96 57..128 159 41.7 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:51:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH15777-PA 138 GH15777-PA 1..128 1..130 631 90 Plus
Dgri\GH15282-PA 200 GH15282-PA 66..172 19..128 169 33.6 Plus
Dgri\GH18250-PA 637 GH18250-PA 34..115 58..139 169 40.2 Plus
Dgri\GH18294-PA 1152 GH18294-PA 96..158 58..121 166 43.8 Plus
Dgri\GH19216-PA 971 GH19216-PA 675..746 58..128 163 41.7 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:19:00
Subject Length Description Subject Range Query Range Score Percent Strand
ckd-PE 140 CG14959-PE 1..140 1..140 789 100 Plus
ckd-PD 140 CG14959-PD 1..140 1..140 789 100 Plus
ckd-PC 140 CG14959-PC 1..140 1..140 789 100 Plus
CG14880-PA 637 CG14880-PA 48..129 58..139 176 40.2 Plus
CG14880-PB 637 CG14880-PB 48..129 58..139 176 40.2 Plus
CG13675-PC 151 CG13675-PC 69..139 58..128 173 42.3 Plus
CG13675-PD 355 CG13675-PD 69..139 58..128 173 42.3 Plus
CG14304-PC 942 CG14304-PC 666..737 58..128 168 43.1 Plus
CG14304-PB 1136 CG14304-PB 860..931 58..128 168 43.1 Plus
CG14304-PA 1136 CG14304-PA 860..931 58..128 168 43.1 Plus
thw-PC 1137 CG14608-PC 109..171 58..121 162 45.3 Plus
CG14301-PB 196 CG14301-PB 111..172 67..128 158 43.5 Plus
CG5756-PB 742 CG5756-PB 67..137 58..125 156 44.4 Plus
CG5756-PC 1220 CG5756-PC 67..137 58..125 156 44.4 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI12556-PA 138 GI12556-PA 1..128 1..130 646 92.3 Plus
Dmoj\GI23649-PA 625 GI23649-PA 30..117 52..139 168 38.6 Plus
Dmoj\GI24104-PA 1130 GI24104-PA 73..135 58..121 165 43.8 Plus
Dmoj\GI24252-PA 1098 GI24252-PA 799..870 58..128 165 41.7 Plus
Dmoj\GI11993-PA 323 GI11993-PA 41..112 57..128 164 43.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL21236-PA 305 GL21236-PA 1..68 1..68 350 95.6 Plus
Dper\GL22245-PA 658 GL22245-PA 46..127 58..139 175 40.2 Plus
Dper\GL12429-PA 1215 GL12429-PA 96..158 58..121 168 45.3 Plus
Dper\GL10537-PA 1248 GL10537-PA 71..140 58..124 153 42.3 Plus
Dper\GL23171-PA 196 GL23171-PA 111..172 67..128 150 43.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13384-PA 140 GA13384-PA 1..140 1..140 753 98.6 Plus
Dpse\GA13317-PA 658 GA13317-PA 46..127 58..139 175 40.2 Plus
Dpse\GA12893-PA 1184 GA12893-PA 905..976 58..128 171 43.1 Plus
Dpse\GA12452-PA 336 GA12452-PA 46..165 8..128 169 33.3 Plus
Dpse\GA13107-PB 1142 GA13107-PB 96..158 58..121 168 45.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:51:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM14552-PA 140 GM14552-PA 1..140 1..140 755 99.3 Plus
Dsec\GM15438-PA 641 GM15438-PA 48..129 58..139 174 40.2 Plus
Dsec\GM10942-PA 1121 GM10942-PA 96..158 58..121 169 45.3 Plus
Dsec\GM18696-PA 1152 GM18696-PA 876..947 58..128 169 43.1 Plus
Dsec\GM24965-PA 315 GM24965-PA 55..126 57..128 159 41.7 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD13744-PA 140 GD13744-PA 1..140 1..140 755 99.3 Plus
Dsim\GD20294-PA 641 GD20294-PA 48..129 58..139 167 40.2 Plus
Dsim\GD13016-PA 282 GD13016-PA 25..96 57..128 159 41.7 Plus
Dsim\GD25417-PA 1225 GD25417-PA 8..137 14..125 151 32.8 Plus
Dsim\GD20160-PA 185 GD20160-PA 100..161 67..128 148 43.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:51:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ15459-PA 138 GJ15459-PA 1..128 1..130 641 90.8 Plus
Dvir\GJ23493-PA 616 GJ23493-PA 37..118 58..139 175 40.2 Plus
Dvir\GJ12216-PA 213 GJ12216-PA 80..186 19..128 169 34.5 Plus
Dvir\GJ10824-PA 1126 GJ10824-PA 837..908 58..128 166 41.7 Plus
Dvir\GJ10927-PA 1173 GJ10927-PA 97..159 58..121 166 43.8 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK10603-PA 140 GK10603-PA 1..130 1..130 658 90.8 Plus
Dwil\GK14170-PA 1051 GK14170-PA 767..838 58..128 177 44.4 Plus
Dwil\GK10819-PA 1146 GK10819-PA 96..158 58..121 169 45.3 Plus
Dwil\GK13506-PA 624 GK13506-PA 52..133 58..139 165 39 Plus
Dwil\GK19836-PA 338 GK19836-PA 54..125 57..128 164 43.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:51:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE21344-PA 140 GE21344-PA 1..140 1..140 757 99.3 Plus
Dyak\GE26319-PA 641 GE26319-PA 48..129 58..139 175 40.2 Plus
Dyak\GE24913-PA 1058 GE24913-PA 95..157 58..121 172 45.3 Plus
Dyak\GE13937-PA 1226 GE13937-PA 8..137 14..125 163 34.3 Plus
Dyak\GE20368-PA 282 GE20368-PA 25..96 57..128 159 41.7 Plus