RE25177.complete Sequence
405 bp (405 high quality bases) assembled on 2002-04-21
GenBank Submission: AY113431
> RE25177.complete
CCACTCAGAGTTCAGCAGCTCGTCCGTCGATAAGCAACAGCCAGCCAGCA
ATCCTAAAAGCCCAAAAAATCCAATCAACATGAAGTTCTTCGCTGTCCTC
GTCTGTTTCTCCGCTGTCCTGGCCATCGCAATGGCATCTACCGCAACTAC
AACCAGCACTCCCACAACGCCCTCTTCGCCCACGACGACGACGTACACCT
ATACTACCACCCCGACCTACCCCACCTACACCTACACCACGGACACCACC
ACCACTAAGCCAATCAAGCAACAGCTCCTGTCCCTGCTGTTCAACAAGAA
GTCCGGATAGAGCCGCCCATCCGATCCACGATGCTGCCACTTGATACGAT
CCTCATCACCTGAATAGCCAAATAAAAACACCAAATACCAAAAAAAAAAA
AAAAA
RE25177.complete Blast Records
Blast to MB8.fasta performed 2010-07-15 19:13:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13159-RA | 403 | CG13159-RA | 3..400 | 2..399 | 1975 | 99.7 | Plus |
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:02:48
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
chr2R | 21145070 | chr2R | 8262543..8262936 | 2..389 | 1830 | 98.2 | Plus |
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:02:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12375291..12375688 | 2..399 | 1975 | 99.7 | Plus |
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25260384 | 2R | 12376490..12376887 | 2..399 | 1975 | 99.7 | Plus |
Blast to na_te.dros performed on 2019-03-16 13:02:46 has no hits.
RE25177.complete Sim4 Records
Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:03 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
chr2R | 8262541..8262678 | 1..137 | 99 | == | Plus |
chr2R | 8262805..8262936 | 258..389 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:34 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..231 | 80..310 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:53 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..231 | 80..310 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:41:02 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..231 | 80..310 | 100 | | Plus |
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:12 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..231 | 80..310 | 100 | | Plus |
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:08:24 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..231 | 80..310 | 100 | | Plus |
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:44 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..390 | 1..389 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:53 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..390 | 1..389 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:41:02 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 4..393 | 1..389 | 99 | | Plus |
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:12 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 1..390 | 1..389 | 99 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:08:24 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13159-RA | 4..393 | 1..389 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12375289..12375678 | 1..389 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12375289..12375678 | 1..389 | 99 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12375289..12375678 | 1..389 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:41:02 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8262794..8263183 | 1..389 | 99 | | Plus |
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:20 Download gff for
RE25177.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12376488..12376877 | 1..389 | 99 | | Plus |
RE25177.hyp Sequence
Translation from 0 to 309
> RE25177.hyp
HSEFSSSSVDKQQPASNPKSPKNPINMKFFAVLVCFSAVLAIAMASTATT
TSTPTTPSSPTTTTYTYTTTPTYPTYTYTTDTTTTKPIKQQLLSLLFNKK
SG*
RE25177.hyp Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:07
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13159-PA | 76 | CG13159-PA | 1..76 | 27..102 | 389 | 100 | Plus |
RE25177.pep Sequence
Translation from 79 to 309
> RE25177.pep
MKFFAVLVCFSAVLAIAMASTATTTSTPTTPSSPTTTTYTYTTTPTYPTY
TYTTDTTTTKPIKQQLLSLLFNKKSG*
RE25177.pep Blast Records
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:39:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dere\GG20285-PA | 81 | GG20285-PA | 1..81 | 1..76 | 144 | 53.1 | Plus |
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13159-PA | 76 | CG13159-PA | 1..76 | 1..76 | 389 | 100 | Plus |
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:39:32
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsec\GM21372-PA | 78 | GM21372-PA | 1..78 | 1..76 | 152 | 71.8 | Plus |
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:39:33
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dsim\GD10869-PA | 78 | GD10869-PA | 1..78 | 1..76 | 152 | 74.4 | Plus |
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:39:34
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Dyak\GE12445-PA | 76 | GE12445-PA | 1..76 | 1..76 | 158 | 67.1 | Plus |