Clone RE25177 Report

Search the DGRC for RE25177

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:251
Well:77
Vector:pFlc-1
Associated Gene/TranscriptCG13159-RA
Protein status:RE25177.pep: gold
Preliminary Size:231
Sequenced Size:405

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG13159 2002-01-01 Sim4 clustering to Release 2
CG13159 2002-04-21 Blastp of sequenced clone
CG13159 2003-01-01 Sim4 clustering to Release 3
CG13159 2008-04-29 Release 5.5 accounting
CG13159 2008-08-15 Release 5.9 accounting
CG13159 2008-12-18 5.12 accounting

Clone Sequence Records

RE25177.complete Sequence

405 bp (405 high quality bases) assembled on 2002-04-21

GenBank Submission: AY113431

> RE25177.complete
CCACTCAGAGTTCAGCAGCTCGTCCGTCGATAAGCAACAGCCAGCCAGCA
ATCCTAAAAGCCCAAAAAATCCAATCAACATGAAGTTCTTCGCTGTCCTC
GTCTGTTTCTCCGCTGTCCTGGCCATCGCAATGGCATCTACCGCAACTAC
AACCAGCACTCCCACAACGCCCTCTTCGCCCACGACGACGACGTACACCT
ATACTACCACCCCGACCTACCCCACCTACACCTACACCACGGACACCACC
ACCACTAAGCCAATCAAGCAACAGCTCCTGTCCCTGCTGTTCAACAAGAA
GTCCGGATAGAGCCGCCCATCCGATCCACGATGCTGCCACTTGATACGAT
CCTCATCACCTGAATAGCCAAATAAAAACACCAAATACCAAAAAAAAAAA
AAAAA

RE25177.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:13:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-RA 403 CG13159-RA 3..400 2..399 1975 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 13:02:48
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 8262543..8262936 2..389 1830 98.2 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:27 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 13:02:46
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12375291..12375688 2..399 1975 99.7 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:44:13
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 12376490..12376887 2..399 1975 99.7 Plus
Blast to na_te.dros performed on 2019-03-16 13:02:46 has no hits.

RE25177.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 13:04:03 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 8262541..8262678 1..137 99 == Plus
chr2R 8262805..8262936 258..389 100   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:34 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..231 80..310 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:59:53 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..231 80..310 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 15:41:02 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..231 80..310 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:53:12 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..231 80..310 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 11:08:24 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..231 80..310 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 21:40:44 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..390 1..389 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:59:53 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..390 1..389 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 15:41:02 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 4..393 1..389 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:53:12 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 1..390 1..389 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 11:08:24 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
CG13159-RA 4..393 1..389 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12375289..12375678 1..389 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12375289..12375678 1..389 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 13:04:03 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12375289..12375678 1..389 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 15:41:02 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8262794..8263183 1..389 99   Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:25:20 Download gff for RE25177.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12376488..12376877 1..389 99   Plus

RE25177.hyp Sequence

Translation from 0 to 309

> RE25177.hyp
HSEFSSSSVDKQQPASNPKSPKNPINMKFFAVLVCFSAVLAIAMASTATT
TSTPTTPSSPTTTTYTYTTTPTYPTYTYTTDTTTTKPIKQQLLSLLFNKK
SG*

RE25177.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:21:07
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-PA 76 CG13159-PA 1..76 27..102 389 100 Plus

RE25177.pep Sequence

Translation from 79 to 309

> RE25177.pep
MKFFAVLVCFSAVLAIAMASTATTTSTPTTPSSPTTTTYTYTTTPTYPTY
TYTTDTTTTKPIKQQLLSLLFNKKSG*

RE25177.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 01:39:30
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20285-PA 81 GG20285-PA 1..81 1..76 144 53.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:49:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG13159-PA 76 CG13159-PA 1..76 1..76 389 100 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 01:39:32
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM21372-PA 78 GM21372-PA 1..78 1..76 152 71.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 01:39:33
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10869-PA 78 GD10869-PA 1..78 1..76 152 74.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 01:39:34
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE12445-PA 76 GE12445-PA 1..76 1..76 158 67.1 Plus