Clone RE25242 Report

Search the DGRC for RE25242

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:252
Well:42
Vector:pFlc-1
Associated Gene/TranscriptAPC10-RA
Protein status:RE25242.pep: gold
Preliminary Size:1077
Sequenced Size:880

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11419 2002-01-01 Sim4 clustering to Release 2
CG11419 2002-06-10 Blastp of sequenced clone
CG11419 2003-01-01 Sim4 clustering to Release 3
CG11419 2008-04-29 Release 5.5 accounting
CG11419 2008-08-15 Release 5.9 accounting
CG11419 2008-12-18 5.12 accounting

Clone Sequence Records

RE25242.complete Sequence

880 bp (880 high quality bases) assembled on 2002-06-10

GenBank Submission: AY071207

> RE25242.complete
AGCTGATTTGTGCGTCTTCAAGCGGCTTCTGTATAATAAAATTTAGATAG
TTTTTTAAAATCGTAATTGCTGCAATGGCAGCCTCAATGGATGAGGATAT
AACCGCCAACCCGCCCCCAAGCAGCGAAGAGGACCCCCTGGCCGAGGAGC
GCCTAGGCTTTGTGCGGGAAGTGGGCGCGCAGGCTGTTTGGAGCCTCTCC
TCCTGCAAGCCGGGATTTGGTGTAGAGCGTTTGCGAGACAACATCATGGA
TACTTATTGGCAGTCGGACGGTCAGCTTCCCCACCTGGTCAACATTCAAT
TCCACAAGCGTACGAACATCAGTCAGATTTACATATACACGGATTACAAG
CTGGACGAGAGTTACACGCCATCAAGGATCTCCATACGATCTGGAACGAA
CTTCAACGACTTGCAGGAGCTGCAGGTGATGGACCTGACCGAACCCACCG
GCTGGGTGCAGATACCCATTAAGGATGGGAACGTCAAGTCCATACGCACC
TTCATGCTTCAGATTGCTGTGATCTCGAACCACCAGAATGGCAGGGACAC
CCACATGCGCCAGATCCGCATCCATGCGCCCGTCGAGGGCAAGCACTATC
CTCTGGAACTGTTTGGCAAGTTTGGAACGGTCGACTTTCAGAAGTTCGCC
ACCATTCGTTAGGGAAAACTTTGGGATTTATCGAAGTCTTTTATTTTTAT
GTATTTTTCGGGGTATATAACTGCTAAAATACAACATTTAAAACATTACT
TTAGTAATTTTATGCATATTTTTGGTGTTTCTAATTAAATGCCCGTCACT
TGTATATATATAATTCGAATGCAAATAAATATATACCGTCGTCTAAGCTT
AAGTACAAATTAACAAAAAAAAAAAAAAAA

RE25242.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 18:49:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG11419-RA 891 CG11419-RA 28..891 1..864 4320 100 Plus
CG4853.b 2826 CG4853.b 2639..2826 867..680 940 100 Minus
CG4853-RA 2841 CG4853-RA 2654..2841 867..680 940 100 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:42:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 13404330..13404982 864..213 3185 99.5 Minus
chr2R 21145070 chr2R 13405040..13405253 214..1 1070 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:29 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:42:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17517258..17517912 867..213 3275 100 Minus
2R 25286936 2R 17517970..17518183 214..1 1070 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:22:08
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 17518457..17519111 867..213 3275 100 Minus
2R 25260384 2R 17519169..17519382 214..1 1070 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:42:36 has no hits.

RE25242.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:43:45 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 13404330..13404981 214..864 99 <- Minus
chr2R 13405041..13405253 1..213 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:37 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
CG11419-RA 1..588 75..662 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:24:56 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
Apc10-RA 1..588 75..662 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:55:58 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
APC10-RA 1..588 75..662 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 18:15:28 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
CG11419-RA 1..588 75..662 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:28 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
APC10-RA 1..588 75..662 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 20:52:34 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
CG11419-RA 1..864 1..864 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:24:56 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
Apc10-RA 1..864 1..864 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:55:58 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
APC10-RA 4..867 1..864 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 18:15:28 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
CG11419-RA 1..864 1..864 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:28 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
APC10-RA 4..867 1..864 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:45 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17517261..17517911 214..864 100 <- Minus
2R 17517971..17518183 1..213 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:45 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17517261..17517911 214..864 100 <- Minus
2R 17517971..17518183 1..213 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:45 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17517261..17517911 214..864 100 <- Minus
2R 17517971..17518183 1..213 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:55:58 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13404766..13405416 214..864 100 <- Minus
arm_2R 13405476..13405688 1..213 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 14:48:36 Download gff for RE25242.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17518460..17519110 214..864 100 <- Minus
2R 17519170..17519382 1..213 100   Minus

RE25242.pep Sequence

Translation from 74 to 661

> RE25242.pep
MAASMDEDITANPPPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGV
ERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYTPS
RISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKSIRTFMLQIAVI
SNHQNGRDTHMRQIRIHAPVEGKHYPLELFGKFGTVDFQKFATIR*

RE25242.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 19:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11781-PA 195 GF11781-PA 1..195 1..195 1016 95.9 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 19:20:45
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21047-PA 195 GG21047-PA 1..195 1..195 1045 99.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 19:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH20482-PA 197 GH20482-PA 1..197 1..195 958 89.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:16:40
Subject Length Description Subject Range Query Range Score Percent Strand
APC10-PA 195 CG11419-PA 1..195 1..195 1029 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 19:20:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI21024-PA 197 GI21024-PA 1..197 1..195 961 89.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 19:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL10659-PA 195 GL10659-PA 1..195 1..195 995 94.4 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 19:20:47
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10993-PA 195 GA10993-PA 1..195 1..195 995 94.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 19:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM19974-PA 195 GM19974-PA 1..195 1..195 1054 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 19:20:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD25470-PA 195 GD25470-PA 1..195 1..195 1054 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 19:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21948-PA 197 GJ21948-PA 1..197 1..195 976 91.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 19:20:49
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK23298-PA 197 GK23298-PA 1..197 1..195 966 91.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 19:20:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13990-PA 195 GE13990-PA 1..195 1..195 1045 99.5 Plus

RE25242.hyp Sequence

Translation from 74 to 661

> RE25242.hyp
MAASMDEDITANPPPSSEEDPLAEERLGFVREVGAQAVWSLSSCKPGFGV
ERLRDNIMDTYWQSDGQLPHLVNIQFHKRTNISQIYIYTDYKLDESYTPS
RISIRSGTNFNDLQELQVMDLTEPTGWVQIPIKDGNVKSIRTFMLQIAVI
SNHQNGRDTHMRQIRIHAPVEGKHYPLELFGKFGTVDFQKFATIR*

RE25242.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:59:59
Subject Length Description Subject Range Query Range Score Percent Strand
APC10-PA 195 CG11419-PA 1..195 1..195 1029 100 Plus