BDGP Sequence Production Resources |
Search the DGRC for RE25263
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 252 |
Well: | 63 |
Vector: | pFlc-1 |
Associated Gene/Transcript | RpL30-RB |
Protein status: | RE25263.pep: gold |
Sequenced Size: | 473 |
Gene | Date | Evidence |
---|---|---|
CG10652 | 2001-12-14 | Blastp of sequenced clone |
CG10652 | 2002-01-01 | Sim4 clustering to Release 2 |
RpL30 | 2008-04-29 | Release 5.5 accounting |
RpL30 | 2008-08-15 | Release 5.9 accounting |
RpL30 | 2008-12-18 | 5.12 accounting |
473 bp (473 high quality bases) assembled on 2001-12-14
GenBank Submission: AY071208
> RE25263.complete CTTTTTTCTTTTGCCATTGTCAGCCGACGAAGTGCTTTAACCCAAACTAT CAACATGGTGGCCGTTAAGAAACAAAAGAAGGCTCTGGAGAGCACCAACG CCCGTCTGGCGCTGGTGATGAAGTCCGGCAAATACTGCCTGGGCTACAAG CAGACCTTGAAGACCCTGCGCCAGGGCAAGGCCAAACTGGTGCTCATCGC CAGCAACACGCCCGCCCTGAGGAAGTCCGAGATCGAGTACTACGCTATGC TGGCCAAGACTGAAGTCCAGCACTACAGCGGCACCAACATCGAGCTGGGC ACCGCCTGTGGTAAATACTTCCGCGTGTGCACCCTGTCCATCACCGATCC TGGAGATTCGGACATCATCCGCTCGCTGGAGACGGCCTAAACATTTATTT TTAATCGAACAAGACGACACAATAAAGTTTTGTATGAGCAGAGATAAAGT TTAAAATAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2L | 23513712 | 2L | 19008303..19008545 | 462..220 | 1215 | 100 | Minus |
2L | 23513712 | 2L | 19008948..19009139 | 222..31 | 960 | 100 | Minus |
2L | 23513712 | 2L | 19009205..19009232 | 32..5 | 140 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2L | 19007656..19007844 | 33..221 | 100 | <- | Minus |
chr2L | 19007912..19007942 | 1..32 | 93 | Minus | |
chr2L | 19007015..19007250 | 222..457 | 99 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RA | 1..336 | 55..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RB | 1..336 | 55..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RC | 1..336 | 55..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RC | 1..336 | 55..390 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RB | 2..456 | 4..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RC | 38..494 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RC | 2..458 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RB | 2..456 | 4..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
RpL30-RC | 71..527 | 1..457 | 99 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19008308..19008543 | 222..457 | 100 | <- | Minus |
2L | 19008949..19009137 | 33..221 | 100 | <- | Minus |
2L | 19009205..19009235 | 1..32 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19008308..19008543 | 222..457 | 100 | <- | Minus |
2L | 19008949..19009137 | 33..221 | 100 | <- | Minus |
2L | 19009205..19009235 | 1..32 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19008308..19008543 | 222..457 | 100 | <- | Minus |
2L | 19008949..19009137 | 33..221 | 100 | <- | Minus |
2L | 19009205..19009235 | 1..32 | 93 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2L | 19008949..19009137 | 33..221 | 100 | <- | Minus |
arm_2L | 19009205..19009235 | 1..32 | 93 | Minus | |
arm_2L | 19008308..19008543 | 222..457 | 100 | <- | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2L | 19008308..19008543 | 222..457 | 100 | <- | Minus |
2L | 19008949..19009137 | 33..221 | 100 | <- | Minus |
2L | 19009205..19009235 | 1..32 | 93 | Minus |
Translation from 3 to 389
> RE25263.hyp LSFAIVSRRSALTQTINMVAVKKQKKALESTNARLALVMKSGKYCLGYKQ TLKTLRQGKAKLVLIASNTPALRKSEIEYYAMLAKTEVQHYSGTNIELGT ACGKYFRVCTLSITDPGDSDIIRSLETA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL30-PE | 111 | CG10652-PE | 1..111 | 18..128 | 556 | 100 | Plus |
RpL30-PB | 111 | CG10652-PB | 1..111 | 18..128 | 556 | 100 | Plus |
RpL30-PC | 111 | CG10652-PC | 1..111 | 18..128 | 556 | 100 | Plus |
Translation from 54 to 389
> RE25263.pep MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIAS NTPALRKSEIEYYAMLAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPG DSDIIRSLETA*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF22555-PA | 111 | GF22555-PA | 1..108 | 1..108 | 559 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG21664-PA | 111 | GG21664-PA | 1..111 | 1..111 | 574 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH11856-PA | 111 | GH11856-PA | 1..108 | 1..108 | 554 | 98.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
RpL30-PE | 111 | CG10652-PE | 1..111 | 1..111 | 556 | 100 | Plus |
RpL30-PB | 111 | CG10652-PB | 1..111 | 1..111 | 556 | 100 | Plus |
RpL30-PC | 111 | CG10652-PC | 1..111 | 1..111 | 556 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10914-PA | 111 | GI10914-PA | 1..108 | 1..108 | 559 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL15908-PA | 111 | GL15908-PA | 1..108 | 1..108 | 554 | 99.1 | Plus |
Dper\GL24326-PA | 111 | GL24326-PA | 1..108 | 1..108 | 551 | 97.2 | Plus |
Dper\GL20290-PA | 102 | GL20290-PA | 8..95 | 18..105 | 266 | 54.5 | Plus |
Dper\GL14340-PA | 106 | GL14340-PA | 8..101 | 18..111 | 241 | 55.3 | Plus |
Dper\GL14343-PA | 102 | GL14343-PA | 8..98 | 18..108 | 190 | 45.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA25213-PA | 111 | GA25213-PA | 1..108 | 1..108 | 554 | 99.1 | Plus |
Dpse\GA26575-PA | 111 | GA26575-PA | 1..108 | 1..108 | 551 | 97.2 | Plus |
Dpse\GA28688-PA | 102 | GA28688-PA | 8..95 | 18..105 | 257 | 54.5 | Plus |
Dpse\GA22980-PA | 106 | GA22980-PA | 8..101 | 18..111 | 239 | 54.3 | Plus |
Dpse\GA22982-PA | 102 | GA22982-PA | 8..98 | 18..108 | 188 | 44 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM17042-PA | 90 | GM17042-PA | 1..90 | 22..111 | 475 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD21790-PA | 111 | GD21790-PA | 1..111 | 1..111 | 576 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ18560-PA | 111 | GJ18560-PA | 1..108 | 1..108 | 559 | 99.1 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK25697-PA | 111 | GK25697-PA | 1..108 | 1..108 | 553 | 97.2 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\RpL30-PA | 111 | GE12684-PA | 1..111 | 1..111 | 574 | 99.1 | Plus |