Clone RE25263 Report

Search the DGRC for RE25263

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:252
Well:63
Vector:pFlc-1
Associated Gene/TranscriptRpL30-RB
Protein status:RE25263.pep: gold
Sequenced Size:473

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10652 2001-12-14 Blastp of sequenced clone
CG10652 2002-01-01 Sim4 clustering to Release 2
RpL30 2008-04-29 Release 5.5 accounting
RpL30 2008-08-15 Release 5.9 accounting
RpL30 2008-12-18 5.12 accounting

Clone Sequence Records

RE25263.complete Sequence

473 bp (473 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071208

> RE25263.complete
CTTTTTTCTTTTGCCATTGTCAGCCGACGAAGTGCTTTAACCCAAACTAT
CAACATGGTGGCCGTTAAGAAACAAAAGAAGGCTCTGGAGAGCACCAACG
CCCGTCTGGCGCTGGTGATGAAGTCCGGCAAATACTGCCTGGGCTACAAG
CAGACCTTGAAGACCCTGCGCCAGGGCAAGGCCAAACTGGTGCTCATCGC
CAGCAACACGCCCGCCCTGAGGAAGTCCGAGATCGAGTACTACGCTATGC
TGGCCAAGACTGAAGTCCAGCACTACAGCGGCACCAACATCGAGCTGGGC
ACCGCCTGTGGTAAATACTTCCGCGTGTGCACCCTGTCCATCACCGATCC
TGGAGATTCGGACATCATCCGCTCGCTGGAGACGGCCTAAACATTTATTT
TTAATCGAACAAGACGACACAATAAAGTTTTGTATGAGCAGAGATAAAGT
TTAAAATAAAAAAAAAAAAAAAA

RE25263.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:23
Subject Length Description Subject Range Query Range Score Percent Strand
RpL30-RB 846 RpL30-RB 142..599 5..462 2290 100 Plus
RpL30-RA 812 RpL30-RA 134..565 31..462 2160 100 Plus
RpL30-RA 812 RpL30-RA 41..68 5..32 140 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:42:41
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 19007015..19007252 457..220 1175 99.6 Minus
chr2L 23010047 chr2L 19007655..19007846 222..31 960 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:33 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:42:38
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19008303..19008545 462..220 1215 100 Minus
2L 23513712 2L 19008948..19009139 222..31 960 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:22
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 19008303..19008545 462..220 1215 100 Minus
2L 23513712 2L 19008948..19009139 222..31 960 100 Minus
2L 23513712 2L 19009205..19009232 32..5 140 100 Minus
Blast to na_te.dros performed on 2019-03-15 19:42:39 has no hits.

RE25263.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:43:46 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 19007656..19007844 33..221 100 <- Minus
chr2L 19007912..19007942 1..32 93   Minus
chr2L 19007015..19007250 222..457 99 <- Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:41 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RA 1..336 55..390 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:55:59 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RB 1..336 55..390 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:56:01 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RC 1..336 55..390 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:22:30 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RC 1..336 55..390 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:36 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RB 2..456 4..457 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:55:59 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RC 38..494 1..457 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:56:01 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RC 2..458 1..457 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:35 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RB 2..456 4..457 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:22:30 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
RpL30-RC 71..527 1..457 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:46 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19008308..19008543 222..457 100 <- Minus
2L 19008949..19009137 33..221 100 <- Minus
2L 19009205..19009235 1..32 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:46 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19008308..19008543 222..457 100 <- Minus
2L 19008949..19009137 33..221 100 <- Minus
2L 19009205..19009235 1..32 93   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:43:46 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19008308..19008543 222..457 100 <- Minus
2L 19008949..19009137 33..221 100 <- Minus
2L 19009205..19009235 1..32 93   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:56:01 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 19008949..19009137 33..221 100 <- Minus
arm_2L 19009205..19009235 1..32 93   Minus
arm_2L 19008308..19008543 222..457 100 <- Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:37 Download gff for RE25263.complete
Subject Subject Range Query Range Percent Splice Strand
2L 19008308..19008543 222..457 100 <- Minus
2L 19008949..19009137 33..221 100 <- Minus
2L 19009205..19009235 1..32 93   Minus

RE25263.hyp Sequence

Translation from 3 to 389

> RE25263.hyp
LSFAIVSRRSALTQTINMVAVKKQKKALESTNARLALVMKSGKYCLGYKQ
TLKTLRQGKAKLVLIASNTPALRKSEIEYYAMLAKTEVQHYSGTNIELGT
ACGKYFRVCTLSITDPGDSDIIRSLETA*

RE25263.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:17:54
Subject Length Description Subject Range Query Range Score Percent Strand
RpL30-PE 111 CG10652-PE 1..111 18..128 556 100 Plus
RpL30-PB 111 CG10652-PB 1..111 18..128 556 100 Plus
RpL30-PC 111 CG10652-PC 1..111 18..128 556 100 Plus

RE25263.pep Sequence

Translation from 54 to 389

> RE25263.pep
MVAVKKQKKALESTNARLALVMKSGKYCLGYKQTLKTLRQGKAKLVLIAS
NTPALRKSEIEYYAMLAKTEVQHYSGTNIELGTACGKYFRVCTLSITDPG
DSDIIRSLETA*

RE25263.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:30:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF22555-PA 111 GF22555-PA 1..108 1..108 559 99.1 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG21664-PA 111 GG21664-PA 1..111 1..111 574 99.1 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:30:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH11856-PA 111 GH11856-PA 1..108 1..108 554 98.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:46:16
Subject Length Description Subject Range Query Range Score Percent Strand
RpL30-PE 111 CG10652-PE 1..111 1..111 556 100 Plus
RpL30-PB 111 CG10652-PB 1..111 1..111 556 100 Plus
RpL30-PC 111 CG10652-PC 1..111 1..111 556 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10914-PA 111 GI10914-PA 1..108 1..108 559 99.1 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:30:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL15908-PA 111 GL15908-PA 1..108 1..108 554 99.1 Plus
Dper\GL24326-PA 111 GL24326-PA 1..108 1..108 551 97.2 Plus
Dper\GL20290-PA 102 GL20290-PA 8..95 18..105 266 54.5 Plus
Dper\GL14340-PA 106 GL14340-PA 8..101 18..111 241 55.3 Plus
Dper\GL14343-PA 102 GL14343-PA 8..98 18..108 190 45.1 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA25213-PA 111 GA25213-PA 1..108 1..108 554 99.1 Plus
Dpse\GA26575-PA 111 GA26575-PA 1..108 1..108 551 97.2 Plus
Dpse\GA28688-PA 102 GA28688-PA 8..95 18..105 257 54.5 Plus
Dpse\GA22980-PA 106 GA22980-PA 8..101 18..111 239 54.3 Plus
Dpse\GA22982-PA 102 GA22982-PA 8..98 18..108 188 44 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:30:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM17042-PA 90 GM17042-PA 1..90 22..111 475 100 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD21790-PA 111 GD21790-PA 1..111 1..111 576 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:30:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ18560-PA 111 GJ18560-PA 1..108 1..108 559 99.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK25697-PA 111 GK25697-PA 1..108 1..108 553 97.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:30:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\RpL30-PA 111 GE12684-PA 1..111 1..111 574 99.1 Plus