Clone RE25411 Report

Search the DGRC for RE25411

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:254
Well:11
Vector:pFlc-1
Associated Gene/TranscriptCG7712-RA
Protein status:RE25411.pep: gold
Preliminary Size:458
Sequenced Size:556

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG7712 2001-12-14 Blastp of sequenced clone
CG7712 2002-01-01 Sim4 clustering to Release 2
CG7712 2003-01-01 Sim4 clustering to Release 3
CG7712 2008-04-29 Release 5.5 accounting
CG7712 2008-08-15 Release 5.9 accounting
CG7712 2008-12-18 5.12 accounting

Clone Sequence Records

RE25411.complete Sequence

556 bp (556 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071209

> RE25411.complete
GTCCATTTGTGCGTAGTGAACTGCGGTCACACTGTTCTGCTTGGAGCAAT
TTGGTCGTAGGAAAAACAGAAAGAAATAAAAACAAATCAAATGGCCGGAC
GTGAAGCCGTGAAGCGAGCCGTACAGCAGGTGCGCCCCATCCTGTCCGTG
GACCGCGAGGAGGCCCGTAAGCGTGCCCTCAATCTGTACAAGGCCTGGTA
CCGCCAGATTCCCTACATCGTCATGGACTACGACATCCCCATGACCGTGG
AGCAGTGTCGGGACAAGCTGCGCGAGGAGTTCGTCAAGCATCGCAATGTG
ACCGACATCCGGGTGATCGACATGCTGGTCATCAAGGGCCAAATGGAGCT
TAAGGAATCCGTGGAGATCTGGAAGCAGAAGGGCCATATCATGCGCTACT
GGAAAGAATCGCAGGATCCCAAGCCCACCGACTTCCTCTCAAAATTCATC
CAGGGCGTTAATTAGTTATTCAAATTGAAATAGTTTAAATACAAACTCCG
ACAGAGTGTAAAACGAAACAAAGGGAGTTTTGTGCGCTTCAAAAAAAAAA
AAAAAA

RE25411.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:42:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG7712-RA 815 CG7712-RA 111..655 1..545 2710 99.8 Plus
CG12942-RA 2549 CG12942-RA 2501..2549 545..497 230 97.9 Minus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 12:08:52
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6785258..6785477 220..1 1070 99.1 Minus
chr2R 21145070 chr2R 6784807..6785012 540..335 1000 99 Minus
chr2R 21145070 chr2R 6785065..6785182 337..220 575 99.2 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:42 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 12:08:50
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10897664..10897883 220..1 1100 100 Minus
2R 25286936 2R 10897209..10897419 545..335 1040 99.5 Minus
2R 25286936 2R 10897471..10897588 337..220 590 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:09:19
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10898863..10899082 220..1 1100 100 Minus
2R 25260384 2R 10898408..10898618 545..335 1040 99.5 Minus
2R 25260384 2R 10898670..10898787 337..220 590 100 Minus
Blast to na_te.dros performed on 2019-03-16 12:08:50 has no hits.

RE25411.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 12:09:53 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6784807..6785010 337..540 99 <- Minus
chr2R 6785066..6785181 221..336 99 <- Minus
chr2R 6785258..6785477 1..220 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:47 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:08:01 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 12:53:50 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:32:19 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 10:38:19 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..375 91..465 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:36:49 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:08:01 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 12:53:50 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 3..542 1..540 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:32:19 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 1..540 1..540 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 10:38:19 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
CG7712-RA 3..542 1..540 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:09:53 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10897214..10897417 337..540 100 <- Minus
2R 10897472..10897587 221..336 100 <- Minus
2R 10897664..10897883 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:09:53 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10897214..10897417 337..540 100 <- Minus
2R 10897472..10897587 221..336 100 <- Minus
2R 10897664..10897883 1..220 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 12:09:53 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10897214..10897417 337..540 100 <- Minus
2R 10897472..10897587 221..336 100 <- Minus
2R 10897664..10897883 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 12:53:50 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6784719..6784922 337..540 100 <- Minus
arm_2R 6784977..6785092 221..336 100 <- Minus
arm_2R 6785169..6785388 1..220 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:09:10 Download gff for RE25411.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10898863..10899082 1..220 100   Minus
2R 10898413..10898616 337..540 100 <- Minus
2R 10898671..10898786 221..336 100 <- Minus

RE25411.pep Sequence

Translation from 90 to 464

> RE25411.pep
MAGREAVKRAVQQVRPILSVDREEARKRALNLYKAWYRQIPYIVMDYDIP
MTVEQCRDKLREEFVKHRNVTDIRVIDMLVIKGQMELKESVEIWKQKGHI
MRYWKESQDPKPTDFLSKFIQGVN*

RE25411.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 20:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13389-PA 124 GF13389-PA 1..124 1..124 653 100 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 20:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG22707-PA 124 GG22707-PA 1..124 1..124 647 98.4 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 20:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH22942-PA 124 GH22942-PA 1..124 1..124 631 96 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:12:35
Subject Length Description Subject Range Query Range Score Percent Strand
ND-B14-PB 124 CG7712-PB 1..124 1..124 647 100 Plus
ND-B14-PA 124 CG7712-PA 1..124 1..124 647 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 20:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI18433-PA 124 GI18433-PA 1..124 1..124 634 96 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 20:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL17089-PA 164 GL17089-PA 42..164 2..124 615 93.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 20:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA20535-PA 124 GA20535-PA 1..124 1..124 617 92.7 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 20:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20483-PA 124 GM20483-PA 1..124 1..124 646 98.4 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 20:59:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD15258-PA 124 GD15258-PA 1..124 1..124 653 100 Plus
Dsim\GD15256-PA 124 GD15256-PA 1..124 1..124 653 100 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 20:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ21517-PA 124 GJ21517-PA 1..124 1..124 622 93.5 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 20:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK15672-PA 124 GK15672-PA 1..124 1..124 634 96.8 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 20:59:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE13063-PA 124 GE13063-PA 1..124 1..124 647 98.4 Plus

RE25411.hyp Sequence

Translation from 90 to 464

> RE25411.hyp
MAGREAVKRAVQQVRPILSVDREEARKRALNLYKAWYRQIPYIVMDYDIP
MTVEQCRDKLREEFVKHRNVTDIRVIDMLVIKGQMELKESVEIWKQKGHI
MRYWKESQDPKPTDFLSKFIQGVN*

RE25411.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:25:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG7712-PB 124 CG7712-PB 1..124 1..124 647 100 Plus
CG7712-PA 124 CG7712-PA 1..124 1..124 647 100 Plus