Clone RE25453 Report

Search the DGRC for RE25453

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:254
Well:53
Vector:pFlc-1
Associated Gene/TranscriptMAGE-RA
Protein status:RE25453.pep: gold
Preliminary Size:699
Sequenced Size:955

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG10059 2002-01-01 Sim4 clustering to Release 2
CG10059 2002-02-22 Blastp of sequenced clone
CG10059 2003-01-01 Sim4 clustering to Release 3
MAGE 2008-04-29 Release 5.5 accounting
MAGE 2008-08-15 Release 5.9 accounting
MAGE 2008-12-18 5.12 accounting

Clone Sequence Records

RE25453.complete Sequence

955 bp (955 high quality bases) assembled on 2002-02-22

GenBank Submission: AY089612

> RE25453.complete
ACTTTCAAAAGTGCGAAAAAAAACATATGTTCGCTGCATTCTTGTTGAGT
TGCATTTTAAATAATCAAATAAATTTGATAAATTGGGAGCTTGTTAATCA
AATTAACTCGAAATGGCTAGCACTTCTCGCGCAGCTAGGAGCCAGAATGC
CATCCCCTCGCAGGAAGCGCAACAACCCGTCGATGTGGTCGACGCCAAGG
TTCGCGCCATTCTAAACTACATCCTTGATCATACCGCCCAGAAGATTCCC
ATAAAGGACAAGGATTTGATAGCGGTGGCTGGGGACAAGAGCGAACTGAA
GAAACGCCTGCCGCTGGTCACTAATCTGCTGGCCGAAACATTCGGTATAA
TACTAACCCCACTGGACGCGACCACCAAGACGTTCATCTGCACTGCGGAG
GAGCCGGTGGCCTCCATTCACGAGCTGACGCCGGCTCAACGGCCGCAGTT
CACGCTGCTGTATATTATTCTCATGTACATCTTCCTGCGCGGCAACCGCA
TCGAGGACTCGAAACTGTACGTTATGCTGGAGATGCTCAACATCTATCCA
GACGAAGAACATGGCTACTTCGGCCCCAATCTGCGCAAACAGATCGAGGA
GACGTTTGTGAAGCAACAATATCTGAAGCGGGAACGCTCACAGCTAAGTG
CTTACGATGATTCCAAGACTTTCTTCCTTTGGGGACCACGTGCCAAGGCG
GAGTTCACATTCGAGCAAATGGTGCAATTCGCCTCCAAGCTGCTCAATCA
GCATCCCAAGGTCTTCGGCCATCACCTCTCCATGGCCCAAGAAGGAGTAA
ACGCGGAGTAGAATACCATTCTATGAATAATTTACTACATTTGATCTAAC
AAATTGAAAACCAAACAATATATATAATAATCTAAAATAGAGCCAATTTC
CCATTTATCAGCAAGAAAAGAATATTACGATGATCTTTTAAAAAAAAAAA
AAAAA

RE25453.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:25:44
Subject Length Description Subject Range Query Range Score Percent Strand
MAGE-RA 939 MAGE-RA 1..939 1..939 4695 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 14:07:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 2980307..2981245 939..1 4680 99.9 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:44 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 14:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 7154233..7155176 944..1 4720 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:54:44
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 6895064..6896007 944..1 4720 100 Minus
Blast to na_te.dros performed 2019-03-15 14:07:26
Subject Length Description Subject Range Query Range Score Percent Strand
copia 5143 copia DMCOPIA 5143bp Derived from X02599 (g7740) (Rel. 49, Last updated, Version 4). 4629..4750 914..790 113 57.9 Minus

RE25453.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 14:08:35 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 2980307..2981245 1..939 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:49 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..699 113..811 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 18:38:55 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..699 113..811 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 00:19:17 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..699 113..811 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:09:08 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..699 113..811 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 20:51:08 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..699 113..811 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:04:00 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 18:38:54 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 00:19:17 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 5..943 1..939 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:09:08 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 1..939 1..939 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 20:51:08 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
MAGE-RA 5..943 1..939 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:08:35 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7154238..7155176 1..939 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:08:35 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7154238..7155176 1..939 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 14:08:35 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
3R 7154238..7155176 1..939 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 00:19:17 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 2979960..2980898 1..939 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:43:16 Download gff for RE25453.complete
Subject Subject Range Query Range Percent Splice Strand
3R 6895069..6896007 1..939 100   Minus

RE25453.pep Sequence

Translation from 112 to 810

> RE25453.pep
MASTSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDK
DLIAVAGDKSELKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVA
SIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEH
GYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTF
EQMVQFASKLLNQHPKVFGHHLSMAQEGVNAE*

RE25453.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 00:11:10
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF17319-PA 234 GF17319-PA 1..233 1..232 911 72.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 00:11:11
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG25348-PA 223 GG25348-PA 1..222 1..232 1006 83.2 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 00:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18586-PA 267 GH18586-PA 1..231 1..230 703 60.1 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:58:06
Subject Length Description Subject Range Query Range Score Percent Strand
MAGE-PA 232 CG10059-PA 1..232 1..232 1181 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 00:11:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI24515-PA 265 GI24515-PA 1..239 1..232 638 54.8 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 00:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12195-PA 241 GL12195-PA 1..239 1..230 738 60.7 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 00:11:13
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA10038-PA 241 GA10038-PA 1..239 1..230 724 59.4 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 00:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM10502-PA 233 GM10502-PA 1..232 1..232 1127 90.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 00:11:14
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19499-PA 233 GD19499-PA 1..232 1..232 1141 91.4 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 00:11:15
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ22688-PA 265 GJ22688-PA 1..239 1..232 674 58.2 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 00:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK12737-PA 236 GK12737-PA 1..228 1..226 603 58.3 Plus
Dwil\GK25664-PA 234 GK25664-PA 14..208 22..213 262 34.2 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 00:11:16
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\MAGE-PA 233 GE25812-PA 1..232 1..232 1064 85.8 Plus
Dyak\GE25809-PA 219 GE25809-PA 1..218 1..232 971 79.7 Plus

RE25453.hyp Sequence

Translation from 112 to 810

> RE25453.hyp
MASTSRAARSQNAIPSQEAQQPVDVVDAKVRAILNYILDHTAQKIPIKDK
DLIAVAGDKSELKKRLPLVTNLLAETFGIILTPLDATTKTFICTAEEPVA
SIHELTPAQRPQFTLLYIILMYIFLRGNRIEDSKLYVMLEMLNIYPDEEH
GYFGPNLRKQIEETFVKQQYLKRERSQLSAYDDSKTFFLWGPRAKAEFTF
EQMVQFASKLLNQHPKVFGHHLSMAQEGVNAE*

RE25453.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:33:22
Subject Length Description Subject Range Query Range Score Percent Strand
MAGE-PA 232 CG10059-PA 1..232 1..232 1181 100 Plus