BDGP Sequence Production Resources |
Search the DGRC for RE25483
Library: | RE |
Tissue Source: | Drosophila melanogaster embryo |
Created by: | Piero Carninci, RIKEN Genome Science Laboratory |
Date Registered: | 2000-10-23 |
Comments: | Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI |
Original Plate Number: | 254 |
Well: | 83 |
Vector: | pFlc-1 |
Associated Gene/Transcript | CG11825-RA |
Protein status: | RE25483.pep: gold |
Preliminary Size: | 303 |
Sequenced Size: | 633 |
Gene | Date | Evidence |
---|---|---|
CG11825 | 2002-01-01 | Sim4 clustering to Release 2 |
CG11825 | 2002-05-30 | Blastp of sequenced clone |
CG11825 | 2003-01-01 | Sim4 clustering to Release 3 |
CG11825 | 2008-04-29 | Release 5.5 accounting |
CG11825 | 2008-08-15 | Release 5.9 accounting |
CG11825 | 2008-12-18 | 5.12 accounting |
633 bp (633 high quality bases) assembled on 2002-05-30
GenBank Submission: AY118378
> RE25483.complete ATTCAGTTGTCAATTATCAGGCAAACTAACAAGAAGAGGGAACAAGTTTT CTAACCTATTCAAAATGAGTTCCAATTCTCTATTCGAAACCGACGAAGAT GTCGCTCAGGCAAACAAGTTATCCCGAAAAGTGAAGGAGTCCCCCTTTAT GCTGGTGGGTATTGCCGGATTCGTGGCCGCAGGTTTGATTGGAGCCTACA AATATCGGAACCGAGGCAGCATGAGCACCAGCGTCTTTCTGATGCAGTTG CGTGTGGCTGCCCAGGGAACCGTCGTTGGATGTTTGACAGCCGGATTGGC GTACACCATGGCCAAGGAGTACCTGCTCCACGAGGAACCGAAAAGCAATA CCAGGCCAGACGAATAAATAAGATATAGTAGGATCATCGGCCAAAGACCA AAAATACATACATAAAATGGTGACCGTTAATTAAACTCATCAAATTGCCT ACCTCCCCACCACCTTCATCGAATCAGAAATGGTAGAACAAATTATTCTA GAATTTAAGAAAGTTCTGCAAAGTATTAGCCATCAGGTTTAATCTTAGTT AAAATTAGTTAACTATTAAGCGTACACAATAAAGAATGTTTCTACCAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
chr2R | 21145070 | chr2R | 6308091..6308527 | 437..1 | 2185 | 100 | Minus |
chr2R | 21145070 | chr2R | 6307874..6308032 | 596..438 | 795 | 100 | Minus |
chr3R | 27901430 | chr3R | 7068411..7068588 | 335..158 | 500 | 85.4 | Minus |
chr3R | 27901430 | chr3R | 7069354..7069452 | 160..62 | 210 | 80.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25286936 | 2R | 10420631..10421067 | 437..1 | 2185 | 100 | Minus |
2R | 25286936 | 2R | 10420408..10420572 | 602..438 | 825 | 100 | Minus |
3R | 32079331 | 3R | 11242837..11243014 | 335..158 | 500 | 85.4 | Minus |
3R | 32079331 | 3R | 11243780..11243878 | 160..62 | 225 | 81.8 | Minus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
2R | 25260384 | 2R | 10421830..10422266 | 437..1 | 2185 | 100 | Minus |
2R | 25260384 | 2R | 10421607..10421771 | 602..438 | 825 | 100 | Minus |
3R | 31820162 | 3R | 10983668..10983845 | 335..158 | 500 | 85.3 | Minus |
3R | 31820162 | 3R | 10984611..10984709 | 160..62 | 225 | 81.8 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
chr2R | 6307874..6308032 | 438..596 | 100 | <- | Minus |
chr2R | 6308091..6308527 | 1..437 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..303 | 65..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..303 | 65..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RC | 56..411 | 10..367 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..303 | 65..367 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RC | 56..411 | 10..367 | 98 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..508 | 1..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..596 | 1..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 3..598 | 1..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 1..508 | 1..508 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
CG11825-RA | 3..598 | 1..596 | 100 | Plus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10420414..10420572 | 438..596 | 100 | <- | Minus |
2R | 10420631..10421067 | 1..437 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10420414..10420572 | 438..596 | 100 | <- | Minus |
2R | 10420631..10421067 | 1..437 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10420414..10420572 | 438..596 | 100 | <- | Minus |
2R | 10420631..10421067 | 1..437 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
arm_2R | 6307919..6308077 | 438..596 | 100 | <- | Minus |
arm_2R | 6308136..6308572 | 1..437 | 100 | Minus |
Subject | Subject Range | Query Range | Percent | Splice | Strand |
---|---|---|---|---|---|
2R | 10421830..10422266 | 1..437 | 100 | Minus | |
2R | 10421613..10421771 | 438..596 | 100 | <- | Minus |
Translation from 0 to 366
> RE25483.hyp FSCQLSGKLTRRGNKFSNLFKMSSNSLFETDEDVAQANKLSRKVKESPFM LVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLA YTMAKEYLLHEEPKSNTRPDE*
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11825-PC | 136 | CG11825-PC | 21..136 | 6..121 | 573 | 98.3 | Plus |
CG11825-PA | 100 | CG11825-PA | 1..100 | 22..121 | 500 | 100 | Plus |
CG17734-PA | 101 | CG17734-PA | 1..97 | 22..118 | 411 | 83.5 | Plus |
CG17734-PB | 95 | CG17734-PB | 1..93 | 22..114 | 398 | 84.9 | Plus |
CG11825-PD | 72 | CG11825-PD | 1..72 | 50..121 | 363 | 100 | Plus |
Translation from 64 to 366
> RE25483.pep MSSNSLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNR GSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE *
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dana\GF18164-PA | 101 | GF18164-PA | 1..97 | 1..97 | 423 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dere\GG17229-PA | 101 | GG17229-PA | 1..97 | 1..97 | 433 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dgri\GH18805-PA | 101 | GH18805-PA | 1..97 | 1..97 | 416 | 80.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
CG11825-PA | 100 | CG11825-PA | 1..100 | 1..100 | 500 | 100 | Plus |
CG11825-PC | 136 | CG11825-PC | 37..136 | 1..100 | 500 | 100 | Plus |
CG17734-PA | 101 | CG17734-PA | 1..97 | 1..97 | 411 | 83.5 | Plus |
CG17734-PB | 95 | CG17734-PB | 1..93 | 1..93 | 398 | 84.9 | Plus |
CG11825-PD | 72 | CG11825-PD | 1..72 | 29..100 | 363 | 100 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dmoj\GI10064-PA | 95 | GI10064-PA | 1..93 | 1..93 | 407 | 81.7 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dper\GL12612-PA | 100 | GL12612-PA | 1..97 | 1..98 | 414 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dpse\GA14631-PA | 100 | GA14631-PA | 1..97 | 1..98 | 414 | 79.6 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsec\GM20525-PA | 100 | GM20525-PA | 1..100 | 1..100 | 511 | 96 | Plus |
Dsec\GM26107-PA | 101 | GM26107-PA | 1..97 | 1..97 | 429 | 82.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dsim\GD10739-PA | 100 | GD10739-PA | 1..100 | 1..100 | 507 | 95 | Plus |
Dsim\GD20668-PA | 101 | GD20668-PA | 1..97 | 1..97 | 433 | 83.5 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dvir\GJ23799-PA | 101 | GJ23799-PA | 1..97 | 1..97 | 416 | 79.4 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dwil\GK13290-PA | 102 | GK13290-PA | 5..98 | 4..97 | 414 | 80.9 | Plus |
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
---|---|---|---|---|---|---|---|
Dyak\GE24630-PA | 101 | GE24630-PA | 1..97 | 1..97 | 429 | 82.5 | Plus |