Clone RE25483 Report

Search the DGRC for RE25483

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:254
Well:83
Vector:pFlc-1
Associated Gene/TranscriptCG11825-RA
Protein status:RE25483.pep: gold
Preliminary Size:303
Sequenced Size:633

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG11825 2002-01-01 Sim4 clustering to Release 2
CG11825 2002-05-30 Blastp of sequenced clone
CG11825 2003-01-01 Sim4 clustering to Release 3
CG11825 2008-04-29 Release 5.5 accounting
CG11825 2008-08-15 Release 5.9 accounting
CG11825 2008-12-18 5.12 accounting

Clone Sequence Records

RE25483.complete Sequence

633 bp (633 high quality bases) assembled on 2002-05-30

GenBank Submission: AY118378

> RE25483.complete
ATTCAGTTGTCAATTATCAGGCAAACTAACAAGAAGAGGGAACAAGTTTT
CTAACCTATTCAAAATGAGTTCCAATTCTCTATTCGAAACCGACGAAGAT
GTCGCTCAGGCAAACAAGTTATCCCGAAAAGTGAAGGAGTCCCCCTTTAT
GCTGGTGGGTATTGCCGGATTCGTGGCCGCAGGTTTGATTGGAGCCTACA
AATATCGGAACCGAGGCAGCATGAGCACCAGCGTCTTTCTGATGCAGTTG
CGTGTGGCTGCCCAGGGAACCGTCGTTGGATGTTTGACAGCCGGATTGGC
GTACACCATGGCCAAGGAGTACCTGCTCCACGAGGAACCGAAAAGCAATA
CCAGGCCAGACGAATAAATAAGATATAGTAGGATCATCGGCCAAAGACCA
AAAATACATACATAAAATGGTGACCGTTAATTAAACTCATCAAATTGCCT
ACCTCCCCACCACCTTCATCGAATCAGAAATGGTAGAACAAATTATTCTA
GAATTTAAGAAAGTTCTGCAAAGTATTAGCCATCAGGTTTAATCTTAGTT
AAAATTAGTTAACTATTAAGCGTACACAATAAAGAATGTTTCTACCAAAA
AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

RE25483.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:45
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-RA 988 CG11825-RA 322..923 1..602 3010 100 Plus
CG11825.a 663 CG11825.a 70..651 21..602 2910 100 Plus
CG17734-RA 992 CG17734-RA 298..571 62..335 710 83.9 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 22:41:28
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 6308091..6308527 437..1 2185 100 Minus
chr2R 21145070 chr2R 6307874..6308032 596..438 795 100 Minus
chr3R 27901430 chr3R 7068411..7068588 335..158 500 85.4 Minus
chr3R 27901430 chr3R 7069354..7069452 160..62 210 80.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:45 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 22:41:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 10420631..10421067 437..1 2185 100 Minus
2R 25286936 2R 10420408..10420572 602..438 825 100 Minus
3R 32079331 3R 11242837..11243014 335..158 500 85.4 Minus
3R 32079331 3R 11243780..11243878 160..62 225 81.8 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 20:33:38
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 10421830..10422266 437..1 2185 100 Minus
2R 25260384 2R 10421607..10421771 602..438 825 100 Minus
3R 31820162 3R 10983668..10983845 335..158 500 85.3 Minus
3R 31820162 3R 10984611..10984709 160..62 225 81.8 Minus
Blast to na_te.dros performed on 2019-03-15 22:41:26 has no hits.

RE25483.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 22:42:40 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 6307874..6308032 438..596 100 <- Minus
chr2R 6308091..6308527 1..437 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:04:52 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..303 65..367 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 17:42:43 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..303 65..367 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 06:29:12 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RC 56..411 10..367 98   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:17:08 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..303 65..367 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 01:31:54 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RC 56..411 10..367 98   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:45:05 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..508 1..508 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 17:42:43 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..596 1..596 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 06:29:12 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 3..598 1..596 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:17:09 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 1..508 1..508 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 01:31:54 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
CG11825-RA 3..598 1..596 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:40 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10420414..10420572 438..596 100 <- Minus
2R 10420631..10421067 1..437 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:40 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10420414..10420572 438..596 100 <- Minus
2R 10420631..10421067 1..437 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 22:42:40 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10420414..10420572 438..596 100 <- Minus
2R 10420631..10421067 1..437 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 06:29:12 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 6307919..6308077 438..596 100 <- Minus
arm_2R 6308136..6308572 1..437 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 15:07:11 Download gff for RE25483.complete
Subject Subject Range Query Range Percent Splice Strand
2R 10421830..10422266 1..437 100   Minus
2R 10421613..10421771 438..596 100 <- Minus

RE25483.hyp Sequence

Translation from 0 to 366

> RE25483.hyp
FSCQLSGKLTRRGNKFSNLFKMSSNSLFETDEDVAQANKLSRKVKESPFM
LVGIAGFVAAGLIGAYKYRNRGSMSTSVFLMQLRVAAQGTVVGCLTAGLA
YTMAKEYLLHEEPKSNTRPDE*

RE25483.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 17:16:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-PC 136 CG11825-PC 21..136 6..121 573 98.3 Plus
CG11825-PA 100 CG11825-PA 1..100 22..121 500 100 Plus
CG17734-PA 101 CG17734-PA 1..97 22..118 411 83.5 Plus
CG17734-PB 95 CG17734-PB 1..93 22..114 398 84.9 Plus
CG11825-PD 72 CG11825-PD 1..72 50..121 363 100 Plus

RE25483.pep Sequence

Translation from 64 to 366

> RE25483.pep
MSSNSLFETDEDVAQANKLSRKVKESPFMLVGIAGFVAAGLIGAYKYRNR
GSMSTSVFLMQLRVAAQGTVVGCLTAGLAYTMAKEYLLHEEPKSNTRPDE
*

RE25483.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 22:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF18164-PA 101 GF18164-PA 1..97 1..97 423 80.4 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:10:17
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG17229-PA 101 GG17229-PA 1..97 1..97 433 83.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 22:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18805-PA 101 GH18805-PA 1..97 1..97 416 80.4 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG11825-PA 100 CG11825-PA 1..100 1..100 500 100 Plus
CG11825-PC 136 CG11825-PC 37..136 1..100 500 100 Plus
CG17734-PA 101 CG17734-PA 1..97 1..97 411 83.5 Plus
CG17734-PB 95 CG17734-PB 1..93 1..93 398 84.9 Plus
CG11825-PD 72 CG11825-PD 1..72 29..100 363 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 22:10:18
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI10064-PA 95 GI10064-PA 1..93 1..93 407 81.7 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 22:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12612-PA 100 GL12612-PA 1..97 1..98 414 79.6 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 22:10:19
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA14631-PA 100 GA14631-PA 1..97 1..98 414 79.6 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 22:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM20525-PA 100 GM20525-PA 1..100 1..100 511 96 Plus
Dsec\GM26107-PA 101 GM26107-PA 1..97 1..97 429 82.5 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 22:10:20
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD10739-PA 100 GD10739-PA 1..100 1..100 507 95 Plus
Dsim\GD20668-PA 101 GD20668-PA 1..97 1..97 433 83.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 22:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23799-PA 101 GJ23799-PA 1..97 1..97 416 79.4 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 22:10:21
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13290-PA 102 GK13290-PA 5..98 4..97 414 80.9 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:10:22
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24630-PA 101 GE24630-PA 1..97 1..97 429 82.5 Plus