Clone RE25914 Report

Search the DGRC for RE25914

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:259
Well:14
Vector:pFlc-1
Associated Gene/TranscriptCG34198-RA
Protein status:RE25914.pep: gold
Sequenced Size:559

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG34198 2008-04-29 Release 5.5 accounting
CG34198 2008-08-15 Release 5.9 accounting
CG34198 2008-12-18 5.12 accounting

Clone Sequence Records

RE25914.complete Sequence

559 bp (559 high quality bases) assembled on 2006-08-30

GenBank Submission: BT029141

> RE25914.complete
GAGTGCCGAACTAAACGCGTGCGGTGCAACAAGTACATTTTATAATTGAA
AACAACCGGATTACAACCAATCGAAATGGACCACAGAACTCGCGTTGTGG
AGGTGGTGCAAGTGCCACCCCAACCCTCGACCACGGTGATCGTGCAACCT
CCTCCGCCGCCGCCTCCTCCCAAGGATAACAGTTGCTGTTGTTGTCCTTG
CTGCCCCTGTTGCTGTCAGTGTGGCGAATGCTGTTGCTGCTGCACCATCA
TGTGAAAGACGAAGGTGCCCGCAGGCAAAGGACCTCAGAACCCCTAATTC
GTTACGTTAAATTAACTTTCTATGTCTATGGAGGCCGCAAACAATTCACA
CAGTTTTTTCGTGCAATAAAATTTTACGATTCGTTATAAATAACTCTGTG
TAGGGCTCACACTGTGGTTGCCATTTTTTTTGTGGCGAAGGGAACACGCT
TGGTAACATATTGTCTTACATAAATCCCAATGCGAAAGTACCACAATATA
ATAAAAAGCCAAATTTAATAACATCCCACAAAAAAAAAAAAAAAAAAAAA
AAAAAAAAA

RE25914.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG34198-RA 450 CG34198-RA 1..450 2..451 2250 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 19:33:37
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 15569641..15570168 529..2 2625 99.8 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:44:58 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 19:33:35
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19682441..19682973 534..2 2665 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:09:10
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 19683640..19684172 534..2 2665 100 Minus
Blast to na_te.dros performed 2019-03-15 19:33:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2372..2432 243..183 170 75.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2597..2658 243..182 157 72.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2357..2421 243..182 156 73.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6778..6838 243..180 151 73.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6742..6805 243..180 149 70.3 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6799..6860 243..182 148 71 Minus
roo 9092 roo DM_ROO 9092bp 1093..1154 243..182 148 71 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6823 243..180 139 70.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2325..2384 242..180 137 71.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2378..2444 243..177 137 67.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 1515..1580 245..180 132 66.7 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6736..6794 243..182 132 71 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6842..6903 242..181 130 67.7 Minus
roo 9092 roo DM_ROO 9092bp 1069..1133 243..182 128 70.8 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6811..6874 243..180 122 65.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6830..6893 245..182 122 65.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6850..6913 243..180 122 65.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2450..2526 253..182 121 67.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2768..2834 243..177 119 64.2 Minus
Dmer\R1A3 3772 Dmer\R1A3 MERCR1A3 3772bp 648..728 149..230 119 62.2 Plus
R1A1-element 5356 R1A1-element DMRER1DM 5356bp Derived from X51968 (g8429) (Rel. 23, Last updated, Version 1). 883..967 133..223 116 63.7 Plus
TART-A 13424 TART-A 13424bp 10423..10478 246..193 113 69.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2782..2879 244..151 112 62 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6538..6585 243..198 109 72.9 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2808..2870 242..180 108 63.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6728..6763 215..180 108 77.8 Minus
Tabor 7345 Tabor TABOR 7345bp 56..115 502..444 108 66.7 Minus
Tabor 7345 Tabor TABOR 7345bp 6895..6954 502..444 108 66.7 Minus

RE25914.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 19:34:41 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 15569641..15569926 244..529 100 == Minus
chr2R 15569989..15570168 1..181 98   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:06 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..180 76..255 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:44:31 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..180 76..255 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 03:12:52 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..180 76..255 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:25:26 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..180 76..255 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 22:02:58 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..180 76..255 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:52:44 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..450 2..451 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:44:31 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..450 2..451 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 03:12:52 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 4..532 1..529 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:25:26 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 1..450 2..451 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 22:02:58 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
CG34198-RA 4..532 1..529 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:41 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19682446..19682973 1..529 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:41 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19682446..19682973 1..529 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 19:34:41 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19682446..19682973 1..529 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 03:12:52 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 15569951..15570478 1..529 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:58:22 Download gff for RE25914.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19683645..19684172 1..529 99   Minus

RE25914.hyp Sequence

Translation from 75 to 254

> RE25914.hyp
MDHRTRVVEVVQVPPQPSTTVIVQPPPPPPPPKDNSCCCCPCCPCCCQCG
ECCCCCTIM*

RE25914.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 15:40:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG34198-PA 59 CG34198-PA 1..59 1..59 377 100 Plus

RE25914.pep Sequence

Translation from 75 to 254

> RE25914.pep
MDHRTRVVEVVQVPPQPSTTVIVQPPPPPPPPKDNSCCCCPCCPCCCQCG
ECCCCCTIM*

RE25914.pep Blast Records

Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 22:36:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG20894-PA 59 GG20894-PA 1..59 1..59 266 100 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:19:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG34198-PA 59 CG34198-PA 1..59 1..59 377 100 Plus