Clone RE26296 Report

Search the DGRC for RE26296

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:262
Well:96
Vector:pFlc-1
Associated Gene/TranscriptCG9877-RA
Protein status:RE26296.pep: gold
Preliminary Size:267
Sequenced Size:397

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG9877 2001-12-14 Blastp of sequenced clone
CG9877 2002-01-01 Sim4 clustering to Release 2
CG9877 2003-01-01 Sim4 clustering to Release 3
CG9877 2008-04-29 Release 5.5 accounting
CG9877 2008-08-15 Release 5.9 accounting
CG9877 2008-12-18 5.12 accounting

Clone Sequence Records

RE26296.complete Sequence

397 bp (397 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071218

> RE26296.complete
AACGGTCCAAAACGGAAAGATCTAAAGTGAACAAGCCATCCAAGATGCGA
GCTGCTATCGTGTTTGTCGTTGTGATTTTCGCACTCCTCAGTGTCCTGGA
GGCCGTGCCCGCTCCCCAGTTCGGATATGGTGGCTTCGGAGGCGGATACC
CCGGATACGGCGGATTCGGAGGCGGATATCCTGGCTACGGCGGCTTCGGT
GGCGGATATCCTGGCTACGGTGGCTTTAGGCGCGGCGGATTCGGCGGAGC
CAGTGCCTCGGCCTCGTCCTCGGCCTCCGCTGGCGGATTCGGCGGTGGCT
TCTACGGATAGAAAGTCGAGAAGATGATTAACCCTAAGCCTGTTCAATTC
AAATAAACCAAATAAATATTCTTGTGACTCCAAAAAAAAAAAAAAAA

RE26296.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:45:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-RA 383 CG9877-RA 1..383 1..383 1900 99.7 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-15 16:21:51
Subject Length Description Subject Range Query Range Score Percent Strand
chr2R 21145070 chr2R 18972341..18972721 381..1 1875 99.5 Minus
chr2R 21145070 chr2R 18972496..18972570 196..122 240 88 Minus
chr2R 21145070 chr2R 18972526..18972600 226..152 240 88 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:13 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-15 16:21:49
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 23085879..23086261 383..1 1900 99.7 Minus
2R 25286936 2R 23086036..23086110 196..122 240 88 Minus
2R 25286936 2R 23086066..23086140 226..152 240 88 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:06:00
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25260384 2R 23087078..23087460 383..1 1900 99.7 Minus
Blast to na_te.dros performed on 2019-03-15 16:21:50 has no hits.

RE26296.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-15 16:22:58 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
chr2R 18972341..18972721 1..381 99   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:19 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 45..311 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:39:41 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 45..311 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 02:01:01 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 45..311 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:16:52 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 45..311 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..267 45..311 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 00:44:44 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..381 1..381 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:39:41 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..381 1..381 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 02:01:01 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 8..388 1..381 99   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:16:53 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 1..381 1..381 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-26 21:34:31 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
CG9877-RA 8..388 1..381 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:58 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23085881..23086261 1..381 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:58 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23085881..23086261 1..381 99   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-15 16:22:58 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23085881..23086261 1..381 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 02:01:01 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 18973404..18973784 1..381 99   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 17:52:37 Download gff for RE26296.complete
Subject Subject Range Query Range Percent Splice Strand
2R 23087098..23087478 1..381 99   Minus

RE26296.hyp Sequence

Translation from 2 to 310

> RE26296.hyp
QSKTERSKVNKPSKMRAAIVFVVVIFALLSVLEAVPAPQFGYGGFGGGYP
GYGGFGGGYPGYGGFGGGYPGYGGFRRGGFGGASASASSSASAGGFGGGF
YG*

RE26296.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:20:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-PA 88 CG9877-PA 1..88 15..102 479 100 Plus
CG8157-PB 113 CG8157-PB 1..88 15..102 175 44.4 Plus
CG8157-PA 113 CG8157-PA 1..88 15..102 175 44.4 Plus
CG7294-PA 127 CG7294-PA 4..108 22..99 170 44.8 Plus
Listericin-PA 121 CG9080-PA 55..119 40..98 169 61.5 Plus
CG7294-PA 127 CG7294-PA 49..127 40..102 134 44.3 Plus

RE26296.pep Sequence

Translation from 44 to 310

> RE26296.pep
MRAAIVFVVVIFALLSVLEAVPAPQFGYGGFGGGYPGYGGFGGGYPGYGG
FGGGYPGYGGFRRGGFGGASASASSSASAGGFGGGFYG*

RE26296.pep Blast Records

Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:26:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG9877-PA 88 CG9877-PA 1..88 1..88 479 100 Plus
CG8157-PB 113 CG8157-PB 1..88 1..88 175 44.4 Plus
CG8157-PA 113 CG8157-PA 1..88 1..88 175 44.4 Plus
CG7294-PA 127 CG7294-PA 4..108 8..85 170 44.8 Plus
Listericin-PA 121 CG9080-PA 55..119 26..84 169 61.5 Plus
CG9757-PB 127 CG9757-PB 56..127 24..88 164 50 Plus
CG9757-PA 127 CG9757-PA 56..127 24..88 164 50 Plus
CG9269-PA 146 CG9269-PA 48..114 27..88 162 49.3 Plus
CG17108-PA 342 CG17108-PA 274..342 27..88 161 58.3 Plus
CG5172-PC 106 CG5172-PC 1..84 1..88 158 44.6 Plus
CG5172-PD 172 CG5172-PD 1..84 1..88 158 44.6 Plus
CG34281-PA 106 CG34281-PA 14..80 17..86 152 47.5 Plus
CG7296-PB 161 CG7296-PB 78..142 24..84 152 57.6 Plus
CG7296-PA 161 CG7296-PA 78..142 24..84 152 57.6 Plus
CG7299-PC 177 CG7299-PC 75..147 27..85 150 56.2 Plus
CG7299-PA 177 CG7299-PA 75..147 27..85 150 56.2 Plus
CG7296-PB 161 CG7296-PB 88..161 27..88 149 49.3 Plus
CG7296-PA 161 CG7296-PA 88..161 27..88 149 49.3 Plus
CG14191-PA 193 CG14191-PA 77..163 15..88 147 37.9 Plus
TwdlT-PA 286 CG5812-PA 38..99 29..88 147 57.8 Plus
CG14191-PA 193 CG14191-PA 36..99 29..88 146 48.5 Plus
CG14191-PA 193 CG14191-PA 56..137 26..88 146 43.9 Plus
CG8160-PA 212 CG8160-PA 52..114 23..86 145 50.8 Plus
CG17738-PA 110 CG17738-PA 51..110 25..88 144 50 Plus
TwdlT-PA 286 CG5812-PA 50..112 29..85 141 55.6 Plus
CG7296-PB 161 CG7296-PB 42..105 24..85 138 54.4 Plus
CG7296-PA 161 CG7296-PA 42..105 24..85 138 54.4 Plus
CG15282-PB 79 CG15282-PB 3..78 7..82 138 45.3 Plus
CG15282-PC 79 CG15282-PC 3..78 7..82 138 45.3 Plus
CG15282-PA 79 CG15282-PA 3..78 7..82 138 45.3 Plus
sqd-PD 178 CG16901-PD 85..152 25..85 138 45.6 Plus
sqd-PB 344 CG16901-PB 251..318 25..85 138 45.6 Plus
CG5172-PD 172 CG5172-PD 39..100 27..88 137 50.8 Plus
CG14191-PA 193 CG14191-PA 52..125 27..86 137 44.6 Plus
CG7296-PB 161 CG7296-PB 48..111 24..85 135 55.1 Plus
CG7296-PA 161 CG7296-PA 48..111 24..85 135 55.1 Plus
CG7299-PC 177 CG7299-PC 3..117 11..88 135 40 Plus
CG7299-PA 177 CG7299-PA 3..117 11..88 135 40 Plus
CG15597-PB 149 CG15597-PB 39..124 27..85 135 44.2 Plus
Edg91-PB 151 CG7539-PB 62..144 27..88 135 44.6 Plus
Edg91-PA 159 CG7539-PA 70..152 27..88 135 44.6 Plus
CG7294-PA 127 CG7294-PA 49..127 26..88 134 44.3 Plus
CG8160-PA 212 CG8160-PA 4..96 8..88 134 38.1 Plus
CG4440-PB 79 CG4440-PB 1..79 1..88 133 38.5 Plus
CG4440-PA 79 CG4440-PA 1..79 1..88 133 38.5 Plus
CG8157-PB 113 CG8157-PB 49..111 27..88 132 51.4 Plus
CG8157-PA 113 CG8157-PA 49..111 27..88 132 51.4 Plus
CG14326-PA 137 CG14326-PA 88..137 21..68 132 58.8 Plus
CG17107-PC 96 CG17107-PC 3..91 7..85 131 41.1 Plus
CG17107-PB 96 CG17107-PB 3..91 7..85 131 41.1 Plus
CG17107-PA 96 CG17107-PA 3..91 7..85 131 41.1 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 22:08:12
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE11608-PA 88 GE11608-PA 1..88 1..88 343 96.6 Plus