Clone RE26319 Report

Search the DGRC for RE26319

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:263
Well:19
Vector:pFlc-1
Associated Gene/TranscriptCG14866-RA
Protein status:RE26319.pep: gold
Preliminary Size:1137
Sequenced Size:1774

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG14866 2001-12-14 Blastp of sequenced clone
CG14866 2002-01-01 Sim4 clustering to Release 2
CG14866 2003-01-01 Sim4 clustering to Release 3
CG14866 2008-04-29 Release 5.5 accounting
CG14866 2008-08-15 Release 5.9 accounting
CG14866 2008-12-18 5.12 accounting

Clone Sequence Records

RE26319.complete Sequence

1774 bp (1774 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071219

> RE26319.complete
AGTCGTGGTTTTCAGCTCGACCCAAGCGAACGGACGTCTTTGAACAGCGG
ACGCGGCATAAACCGCACGGAAAACGCAACGAAATCGAAAGTGTTCACCA
CGCGACTGGAATCGCCAAGTGCTTAGCGAGGCGGGGGCAATATACCCATC
CGTAAACATTACGTGTCACCATGCCGCCGGCTGGTCAACAACTCCGGCTT
ACGGCCCTTGTTTATCTGGCATTAGGTATTGCACTCTTATGCAATGGCAG
CGATGGTGAAACTAGGCAAAAATACGCCAATGAATCACTCGCGGACGCAG
ACGATCCATCTCCAGTTTGGTCGCAATTTCTCGAAGATTACGTCTTGAGG
TATGGTTACAGGAGGCTAGGCTAGGGCAACACACTCATCCAGATCTTCCC
ACGCGTCTGTCTTACATATAGCCAAGGCAGCAGTAGCAGCGGCAGCCAGC
GAAAGTCCAAAGACCTGCCTTATATGGGCGCGGACATGGGCATCAATGGA
CCGCTCAGCTATCACTCGTCCGCCTACAAGCGACCCGGCAACAATATCTA
CATCACCAGGAGAATTGGCGAGGCGGTGGAACTAGAGCCGCATCTGCGAA
AGCCCGTGGAGAGCCAGAGTCCCATTGTGAATCCTCAGTTCCGACCCATG
ACCAATCAAATGTTGCACCAGCAACACCAACAGATGCAGCAACAACAGCA
ACAGCAACAGTTGCAGCAACGCCAGCAACCGGGTTTCCTGCAGCAGCTCT
TTGGCATAGGTGGCAGTGGTGGTGGTGGTGGTAGCGGTACCCAGCAACAG
CAACATGTGCGACCAGTGCCGCTGCAACAGCAGCAAGTGCAACAGATAGC
GCAGCAACACCCGCAACAGCAACATCTTGTGGGCGGTCAGCCGACCACAT
TCCGAGCTGTCTCCGAAAATGATCTTTATCTCTTGGGAGCCATTGAAAAG
TTGGTGTATCGAGTGGATTACCTGGAGAGTCGCGTGCGGCGCTCGGAGCA
GCTGATCTACTATCTGATGGCCGGAAACAATCAGAAGGAGGTGAAGGATC
CCTGTCCCGCGAACTTCACGCGCATCAGCGACAACTGCTACTACATCAAC
AGCCAGCAGCAGGTGAACTGGAAGACGGCAAACTCTGCCTGCAAGGGTCT
AAACTCCCACCTGGCCGAGTTCGAGAAGGTCTCGGAGAATGAGGAGATCA
TGGCCTATCTGCTGAATCAGCCGACGCATCGTGGTCGCGATTACTGGCTG
GGCGGTCTCAATCCTGGCCTCCTCTGGATCTGGTCCAATTCGGCTAAGCC
GGTGAATCCCAACATGAATCTCACATCCATTGCGATGGCCCAGAAGGGGG
AGAACTCGACGGCCGCCAATCTGGTGGACAGTTCGGAGCAGGCGGCAGAG
GAGGCGACCGGCGAGGATGTGCTGAACAACACGGTGCAAATAGAGGGCAA
GGGTCGCTGCCTACGGCTAAGTTACAATGCCGGAAAGCACAGCTATGTGT
ACTACGGACAGGAGTGCACCTCGCGGCACTACTACATCTGCGAGCACGAG
GACAAGACGCTGGACAACAAGATCAAGAAGATCACCCGCGAGCTGAAGCT
GTTCGAGTGAGGATGGGATGCAACCCATTCCGATCCTCATGTGATACTTC
AAGTTACCTAGCCATATATCGCATAATTTCAAATGAATTTATTCTTGTGT
TACACATTAAATATTTATAAATATTTATACAATTAATAAACATACCGGAT
AGTTTTCGAAAAAAAAAAAAAAAA

RE26319.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 19:46:32
Subject Length Description Subject Range Query Range Score Percent Strand
CG14866-RA 1791 CG14866-RA 30..1790 1..1761 8790 99.9 Plus
CG14866.a 1823 CG14866.a 481..1822 420..1761 6695 99.9 Plus
CG14866.b 1916 CG14866.b 574..1915 420..1761 6695 99.9 Plus
CG14866.a 1823 CG14866.a 134..482 1..349 1745 100 Plus
CG14866.b 1916 CG14866.b 227..575 1..349 1745 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 01:44:26
Subject Length Description Subject Range Query Range Score Percent Strand
chr3R 27901430 chr3R 11141100..11142065 1..966 4830 100 Plus
chr3R 27901430 chr3R 11142121..11142912 966..1757 3930 99.7 Plus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 01:44:22
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 15316473..15317438 1..966 4830 100 Plus
3R 32079331 3R 15317494..15318289 966..1761 3965 99.9 Plus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 21:12:57
Subject Length Description Subject Range Query Range Score Percent Strand
3R 31820162 3R 15057304..15058269 1..966 4830 100 Plus
3R 31820162 3R 15058325..15059120 966..1761 3965 99.8 Plus
X 23527363 X 11852404..11852468 729..665 190 86.1 Minus
Blast to na_te.dros performed 2019-03-16 01:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6757..6923 665..834 248 62.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6724..6938 686..891 235 59.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2483..2686 665..877 199 58.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2622..2691 666..735 179 72.9 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6782..6864 792..871 174 71.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6740..6824 792..876 173 67.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2311..2409 783..876 168 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2310..2391 792..876 166 68.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6761..6845 792..876 164 65.9 Plus
roo 9092 roo DM_ROO 9092bp 1079..1164 792..877 160 65.1 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6797..6881 792..876 156 68.2 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2376..2463 792..876 153 67 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2302..2376 805..876 151 70.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6727..6797 809..876 150 70.4 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2787..2861 792..869 140 66.7 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6722..6776 819..876 130 72.4 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3259..3336 790..873 127 65.5 Plus
roo 9092 roo DM_ROO 9092bp 1072..1130 818..876 124 67.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2358 824..876 121 69.8 Plus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6503..6617 1037..1153 121 57.3 Plus
Dvir\Het-A 6610 Dvir\Het-A HETAVIR 6610bp 3300..3381 792..874 116 63.5 Plus
roo 9092 roo DM_ROO 9092bp 1097..1173 792..874 113 63.9 Plus

RE26319.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 01:45:46 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
chr3R 11141100..11141763 1..664 100 == Plus
chr3R 11141827..11142065 728..966 87 -> Plus
chr3R 11142122..11142912 967..1758 95   Plus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:20 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RB 1..167 171..337 100 == Plus
CG14866-RB 168..1368 412..1610 99   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 19:14:01 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RB 1..167 171..337 100 == Plus
CG14866-RB 168..1368 412..1610 99   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 07:08:52 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RB 1..167 171..337 100 == Plus
CG14866-RB 168..1368 412..1610 99   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 19:39:20 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RB 1..167 171..337 100 == Plus
CG14866-RB 168..1368 412..1610 99   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 04:40:34 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RB 1..167 171..337 100 == Plus
CG14866-RB 168..1368 412..1610 99   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-10 22:45:26 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RA 1..1757 1..1758 99   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 19:14:00 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RA 1..1757 1..1758 99   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 07:08:52 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RA 3..1759 1..1757 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 19:39:20 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RA 1..1757 1..1758 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 04:40:34 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
CG14866-RA 3..1759 1..1757 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:46 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15316473..15317438 1..966 100 -> Plus
3R 15317495..15318285 967..1758 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:46 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15316473..15317438 1..966 100 -> Plus
3R 15317495..15318285 967..1758 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 01:45:46 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15316473..15317438 1..966 100 -> Plus
3R 15317495..15318285 967..1758 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 07:08:52 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 11143217..11144007 967..1758 99   Plus
arm_3R 11142195..11143160 1..966 100 -> Plus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 16:15:53 Download gff for RE26319.complete
Subject Subject Range Query Range Percent Splice Strand
3R 15057304..15058269 1..966 100 -> Plus
3R 15058326..15059116 967..1758 99   Plus

RE26319.pep Sequence

Translation from 473 to 1609

> RE26319.pep
MGADMGINGPLSYHSSAYKRPGNNIYITRRIGEAVELEPHLRKPVESQSP
IVNPQFRPMTNQMLHQQHQQMQQQQQQQQLQQRQQPGFLQQLFGIGGSGG
GGGSGTQQQQHVRPVPLQQQQVQQIAQQHPQQQHLVGGQPTTFRAVSEND
LYLLGAIEKLVYRVDYLESRVRRSEQLIYYLMAGNNQKEVKDPCPANFTR
ISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEIMAYLLNQP
THRGRDYWLGGLNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANL
VDSSEQAAEEATGEDVLNNTVQIEGKGRCLRLSYNAGKHSYVYYGQECTS
RHYYICEHEDKTLDNKIKKITRELKLFE*

RE26319.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-15 21:24:36
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF11486-PA 464 GF11486-PA 82..464 1..378 1561 86.5 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-15 21:24:38
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG16910-PA 474 GG16910-PA 80..474 1..378 1951 93.9 Plus
Dere\GG16911-PA 136 GG16911-PA 1..136 243..378 733 98.5 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-15 21:24:41
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH18859-PA 409 GH18859-PA 39..409 4..378 1520 81 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 11:08:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14866-PB 455 CG14866-PB 78..455 1..378 2006 100 Plus
CG14866-PA 378 CG14866-PA 1..378 1..378 2006 100 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-15 21:24:44
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22930-PA 393 GI22930-PA 39..393 1..378 1453 77.3 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-15 21:24:46
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL12545-PA 472 GL12545-PA 100..472 8..378 1500 84.5 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-15 21:24:48
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA13305-PB 378 GA13305-PB 1..378 1..378 1530 84.7 Plus
Dpse\GA13305-PA 427 GA13305-PA 57..427 8..378 1514 85.5 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-15 21:24:50
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM24217-PA 461 GM24217-PA 78..461 1..378 1950 95.8 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-15 21:24:51
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD19007-PA 462 GD19007-PA 78..462 1..378 1628 94.5 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-15 21:24:54
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23213-PA 415 GJ23213-PA 42..415 1..378 1447 78.9 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-15 21:24:56
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK13798-PA 426 GK13798-PA 49..426 1..378 1477 82.5 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-15 21:24:58
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE24293-PA 472 GE24293-PA 86..472 1..378 1607 94.3 Plus

RE26319.hyp Sequence

Translation from 473 to 1609

> RE26319.hyp
MGADMGINGPLSYHSSAYKRPGNNIYITRRIGEAVELEPHLRKPVESQSP
IVNPQFRPMTNQMLHQQHQQMQQQQQQQQLQQRQQPGFLQQLFGIGGSGG
GGGSGTQQQQHVRPVPLQQQQVQQIAQQHPQQQHLVGGQPTTFRAVSEND
LYLLGAIEKLVYRVDYLESRVRRSEQLIYYLMAGNNQKEVKDPCPANFTR
ISDNCYYINSQQQVNWKTANSACKGLNSHLAEFEKVSENEEIMAYLLNQP
THRGRDYWLGGLNPGLLWIWSNSAKPVNPNMNLTSIAMAQKGENSTAANL
VDSSEQAAEEATGEDVLNNTVQIEGKGRCLRLSYNAGKHSYVYYGQECTS
RHYYICEHEDKTLDNKIKKITRELKLFE*

RE26319.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 14:34:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG14866-PA 378 CG14866-PA 1..378 1..378 2006 100 Plus
CG14866-PB 455 CG14866-PB 78..455 1..378 2006 100 Plus