Clone RE26329 Report

Search the DGRC for RE26329

Clone and Library Details

Library:RE
Tissue Source:Drosophila melanogaster embryo
Created by:Piero Carninci, RIKEN Genome Science Laboratory
Date Registered:2000-10-23
Comments:Average reported size from P Carninci is 2.3kb. Directionally cloned:5 end at XhoI, 3 end at BamHI
Original Plate Number:263
Well:29
Vector:pFlc-1
Associated Gene/TranscriptTaf10b-RA
Protein status:RE26329.pep: gold
Preliminary Size:917
Sequenced Size:558

Associated Genes

Associations are from manual ordering of a clone or by a periodic analysis.
Gene Date Evidence
CG3069 2001-12-14 Blastp of sequenced clone
CG3069 2002-01-01 Sim4 clustering to Release 2
CG3069 2003-01-01 Sim4 clustering to Release 3
Taf10b 2008-04-29 Release 5.5 accounting

Clone Sequence Records

RE26329.complete Sequence

558 bp (558 high quality bases) assembled on 2001-12-14

GenBank Submission: AY071220

> RE26329.complete
ACTACGTCTGCACTGTGTTTAATTTGTATTGTACACTTTTTTCGATGGTG
GGCTCCAATTTCGGAATTATTTACCACAACAGCGCCGGTGGCGCAAGCAG
TCATGGACAATCCTCGGGAGGAGGTGGCGGTGGAGATCGGGATAGGACCA
CACCATCTTCGCATCTCAGCGACTTCATGTCGCAGCTGGAAGATTATACT
CCATTGATTCCGGATGCGGTCACCTCGCACTATCTCAACATGGGAGGCTT
TCAGTCGGACGACAAGCGCATCGTTCGGCTGATCAGCCTAGCCGCCCAGA
AGTACATGTCCGACATCATCGACGATGCACTGCAGCACTCCAAGGCGCGC
ACCCATATGCAAACCACCAATACACCGGGAGGATCGAAGGCCAAGGACCG
CAAGTTCACCTTGACCATGGAGGATCTGCAGCCGGCTTTGGCCGACTACG
GTATTAATGTTAGGAAAGTGGACTATAGTCAGTAGATAATGGCATGCATT
GTAGTAGTTTTTTTCTCATTAAAAATAATGTATCTTAAAAAAAAAAAAAA
AAAAAAAA

RE26329.complete Blast Records

Blast to MB8.fasta performed 2010-07-15 20:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10b-RA 767 Taf10b-RA 227..764 1..538 2690 100 Plus
Blast to d_melanogaster_OreR.fa performed 2019-03-16 19:32:22
Subject Length Description Subject Range Query Range Score Percent Strand
chr2L 23010047 chr2L 2767007..2767542 536..1 2680 100 Minus
Blast to dmel-all-all_noncoding-r5.12.fasta performed on 2010-04-22 20:45:16 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2019-03-16 19:32:20
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2767284..2767821 538..1 2690 100 Minus
Blast to na_arms.dmel.RELEASE6 performed 2011-12-12 22:16:26
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2767284..2767821 538..1 2690 100 Minus
Blast to na_te.dros performed on 2019-03-16 19:32:20 has no hits.

RE26329.complete Sim4 Records

Sim4 to d_melanogaster_OreR.fa performed 2019-03-16 19:33:18 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
chr2L 2767007..2767542 1..536 100   Minus
Sim4 to dmel-all-CDS-r5.12.fasta performed 2008-12-08 20:05:22 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 1..441 45..485 100   Plus
Sim4 to dmel-all-CDS-r5.32.fasta performed 2011-03-16 20:56:07 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 1..441 45..485 100   Plus
Sim4 to dmel-all-CDS-r5.52.fasta performed 2013-08-04 17:42:44 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 1..441 45..485 100   Plus
Sim4 to dmel-all-CDS-r5.9.fasta performed 2008-07-21 21:38:42 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 1..441 45..485 100   Plus
Sim4 to dmel-all-CDS-r6.02.fasta performed 2014-11-27 15:35:37 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 1..441 45..485 100   Plus
Sim4 to dmel-all-transcript-r5.12.fasta performed 2008-11-11 01:09:46 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 224..759 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.32.fasta performed 2011-03-16 20:56:07 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 227..762 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 17:42:44 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 25..560 1..536 100   Plus
Sim4 to dmel-all-transcript-r5.9.fasta performed 2008-07-21 21:38:42 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 224..759 1..536 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-27 15:35:37 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
Taf10b-RA 25..560 1..536 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:18 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767286..2767821 1..536 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:18 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767286..2767821 1..536 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2019-03-16 19:33:18 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767286..2767821 1..536 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 17:42:44 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2767286..2767821 1..536 100   Minus
Sim4 to na_arms.dmel.RELEASE6 performed 2011-12-09 18:21:47 Download gff for RE26329.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2767286..2767821 1..536 100   Minus

RE26329.hyp Sequence

Translation from 2 to 484

> RE26329.hyp
YVCTVFNLYCTLFSMVGSNFGIIYHNSAGGASSHGQSSGGGGGGDRDRTT
PSSHLSDFMSQLEDYTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQK
YMSDIIDDALQHSKARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADYG
INVRKVDYSQ*

RE26329.hyp Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-28 16:29:23
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10b-PA 146 CG3069-PA 1..146 15..160 759 100 Plus
Taf10-PA 167 CG2859-PA 51..165 49..158 289 53 Plus

RE26329.pep Sequence

Translation from 44 to 484

> RE26329.pep
MVGSNFGIIYHNSAGGASSHGQSSGGGGGGDRDRTTPSSHLSDFMSQLED
YTPLIPDAVTSHYLNMGGFQSDDKRIVRLISLAAQKYMSDIIDDALQHSK
ARTHMQTTNTPGGSKAKDRKFTLTMEDLQPALADYGINVRKVDYSQ*

RE26329.pep Blast Records

Blast to dana-all-translation-r1.3.fasta performed 2019-03-16 14:32:02
Subject Length Description Subject Range Query Range Score Percent Strand
Dana\GF13872-PA 148 GF13872-PA 1..148 1..146 671 87.2 Plus
Dana\GF13893-PA 164 GF13893-PA 27..162 17..144 301 50.7 Plus
Blast to dere-all-translation-r1.3.fasta performed 2019-03-16 14:32:03
Subject Length Description Subject Range Query Range Score Percent Strand
Dere\GG24493-PA 146 GG24493-PA 1..146 1..146 678 93.2 Plus
Dere\GG24883-PA 167 GG24883-PA 51..165 35..144 300 53.9 Plus
Blast to dgri-all-translation-r1.3.fasta performed 2019-03-16 14:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dgri\GH13140-PA 155 GH13140-PA 1..155 1..146 591 74.8 Plus
Dgri\GH11693-PA 162 GH11693-PA 46..160 35..144 291 51.3 Plus
Blast to dmel-all-translation-r6.23.fasta performed 2019-03-25 10:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
Taf10b-PA 146 CG3069-PA 1..146 1..146 759 100 Plus
Taf10-PA 167 CG2859-PA 51..165 35..144 289 53 Plus
Blast to dmoj-all-translation-r1.3.fasta performed 2019-03-16 14:32:04
Subject Length Description Subject Range Query Range Score Percent Strand
Dmoj\GI22891-PA 158 GI22891-PA 1..158 1..146 625 78.5 Plus
Dmoj\GI17138-PA 165 GI17138-PA 49..163 35..144 296 53 Plus
Blast to dper-all-translation-r1.3.fasta performed 2019-03-16 14:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dper\GL26445-PA 153 GL26445-PA 1..153 1..146 595 78.1 Plus
Dper\GL26583-PA 166 GL26583-PA 56..164 41..144 278 52.3 Plus
Blast to dpse-all-translation-r3.2.fasta performed 2019-03-16 14:32:05
Subject Length Description Subject Range Query Range Score Percent Strand
Dpse\GA15905-PA 153 GA15905-PA 1..153 1..146 595 78.1 Plus
Dpse\GA28988-PA 166 GA28988-PA 56..164 41..144 278 52.3 Plus
Blast to dsec-all-translation-r1.3.fasta performed 2019-03-16 14:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsec\GM18200-PA 144 GM18200-PA 1..144 1..146 743 98.6 Plus
Dsec\GM18365-PA 164 GM18365-PA 48..162 35..144 290 51.3 Plus
Blast to dsim-all-translation-r1.4.fasta performed 2019-03-16 14:32:06
Subject Length Description Subject Range Query Range Score Percent Strand
Dsim\GD22805-PA 144 GD22805-PA 1..144 1..146 743 98.6 Plus
Dsim\GD23181-PA 167 GD23181-PA 51..165 35..144 294 52.2 Plus
Blast to dvir-all-translation-r1.2.fasta performed 2019-03-16 14:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dvir\GJ23440-PA 158 GJ23440-PA 1..158 1..146 625 78.5 Plus
Dvir\GJ16180-PA 165 GJ16180-PA 53..163 39..144 292 54.1 Plus
Blast to dwil-all-translation-r1.3.fasta performed 2019-03-16 14:32:07
Subject Length Description Subject Range Query Range Score Percent Strand
Dwil\GK24479-PA 155 GK24479-PA 1..155 1..146 596 76.8 Plus
Dwil\GK24581-PA 173 GK24581-PA 63..171 41..144 275 51.4 Plus
Blast to dyak-all-translation-r1.3.fasta performed 2019-03-16 14:32:08
Subject Length Description Subject Range Query Range Score Percent Strand
Dyak\GE15035-PA 148 GE15035-PA 1..148 1..146 677 95.3 Plus
Dyak\GE18180-PA 167 GE18180-PA 51..165 35..144 300 53.9 Plus